SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene55694

Length: 245 nt

UniGene Fasta

>sp_v3.0_unigene55694
TTGAGACTGTGGATGTAATGGATGCAGTTGGCAGTAACATTGTTGTCTCCATGCGTACAAATGAAGTGATGAGAATCTTACCAAAAATGAACGAGGATATAAATGAGGAATGGATATCGGACAAGACCAGGTTTGCCTATGATGGTCTAAAGAGACAGAGACTGACAGCCCCGTTTGTAAAGAACGACAAAGGTGTCCTTACACAGACAGACTGGGAAGCGGCACTGATTAAAGCTGCAACAAAG

Ace file of the UniGene sp_v3.0_unigene55694

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	PREDICTED: NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial isoform 2 n=1 Tax=Monodelphis domestica RepID=UPI00020F7280	-	-	3.0e-29	77%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	64%
Sma3	NADH-ubiquinone oxidoreductase 75 kDa subunit	-	-	2.495e-30	-

Source	ECs	Term	Type	e value	Identity
Sma3	NADH dehydrogenase (ubiquinone).	EC:1.6.5.3	-	1.721e-14	-

Source	KEGGs	Term	Type	e value	Identity
Sma3	Oxidative phosphorylation	00190		1.721e-14	%
Sma3	Metabolic pathways	01100		1.721e-14	%

Source	Gene names
Sma3	At5g37510; CHLREDRAFT_79362; EMB1467; GSVIVT00022315001; HAM_004; LOC_Os03g50540; MICPUCDRAFT_36280; MICPUN_64564; MPA22.5; NUOS1; OSJNBa0014G15.3; OSTLU_39049; Os03g0713400; OsI_13269; OsJ_12335; Ot12g00450; PHYPADRAFT_168248; PHYPADRAFT_205609; PHYPADRA

Source	GOs	Term	Type	Identity
Sma3	mitochondrion	GO:0005739	Cellular Component	-
Sma3	mitochondrial inner membrane	GO:0005743	Cellular Component	-
Sma3	chloroplast	GO:0009507	Cellular Component	-
Sma3	membrane	GO:0016020	Cellular Component	-
Sma3	respiratory chain complex I	GO:0045271	Cellular Component	-
Sma3	actin binding	GO:0003779	Molecular Function	-
Sma3	iron ion binding	GO:0005506	Molecular Function	-
Sma3	NADH dehydrogenase (ubiquinone) activity	GO:0008137	Molecular Function	-
Sma3	electron carrier activity	GO:0009055	Molecular Function	-
Sma3	iron-sulfur cluster binding	GO:0051536	Molecular Function	-
Sma3	2 iron, 2 sulfur cluster binding	GO:0051537	Molecular Function	-
Sma3	4 iron, 4 sulfur cluster binding	GO:0051539	Molecular Function	-
Sma3	transport	GO:0006810	Biological Process	-
Sma3	response to oxidative stress	GO:0006979	Biological Process	-
Sma3	cytoskeleton organization	GO:0007010	Biological Process	-
Sma3	photorespiration	GO:0009853	Biological Process	-
Sma3	ATP synthesis coupled electron transport	GO:0042773	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	NADH:ubiquinone oxidoreductase, 75kDa subunit, conserved site	IPR000283	-	-
Sma3	2Fe-2S ferredoxin-type domain	IPR001041	-	-
Sma3	2Fe-2S ferredoxin, iron-sulphur binding site	IPR006058	-	-
Sma3	Molybdopterin oxidoreductase	IPR006656	-	-
Sma3	NADH:ubiquinone oxidoreductase, subunit G	IPR010228	-	-
Sma3	Beta-grasp domain	IPR012675	-	-
Sma3	NADH-quinone oxidoreductase, chain G, C-terminal	IPR015405	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT5G37510.2	-	4.0e-26	64%
RefSeq	Arabidopsis thaliana	NP_851103.1	NADH-ubiquinone oxidoreductase subunit [Arabidopsis thaliana]	6.0e-26	64%
RefSeq	Populus trichocarpa	XP_002302917.1	predicted protein [Populus trichocarpa]	1.0e-24	59%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: B8LMM8

Fln msg: Distance to subject end: 378 aas, your sequence is shorter than subject: 81 - 750

Fln protein: ETVDVMDAVGSNIVVSMRTNEVMRILPKMNEDINEEWISDKTRFAYDGLKRQRLTAPFVKNDKGVLTQTDWEAALIKAATK

Protein Length: 82

Fln nts: TTGAGACTGTGGATGTAATGGATGCAGTTGGCAGTAACATTGTTGTCTCCATGCGTACAAATGAAGTGATGAGAATCTTACCAAAAATGAACGAGGATATAAATGAGGAATGGATATCGGACAAGACCAGGTTTGCCTATGATGGTCTAAAGAGACAGAGACTGACAGCCCCGTTTGTAAAGAACGACAAAGGTGTCCTTACACAGACAGACTGGGAAGCGGCACTGATTAAAGCTGCAACAAAG

Fln Alignment:

F585NNT02JAC7V___ETVDVMDAVGSNIVVSMRTNEVMRILPKMNEDINEEWISDKTRFAYDGLKRQRLTAPFVKNDKGVLTQTDWEAAL
B8LMM8_______________ESIDVTDAVGSNIKIDSRGPEVMRILPRLNEDINEEWISDKTRFCYDGLKRQRLNEPMIRRPDGRLQPVTWHDAL

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain