UniGene Name: sp_v3.0_unigene55694
Length: 245 nt
![]() |
---|
>sp_v3.0_unigene55694
T |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | PREDICTED: NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial isoform 2 n=1 Tax=Monodelphis domestica RepID=UPI00020F7280 | - | - | 3.0e-29 | 77% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 64% |
Sma3 | NADH-ubiquinone oxidoreductase 75 kDa subunit | - | - | 2.495e-30 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | NADH dehydrogenase (ubiquinone). | EC:1.6.5.3 | - | 1.721e-14 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Oxidative phosphorylation | 00190 | 1.721e-14 | % | |
Sma3 | Metabolic pathways | 01100 | 1.721e-14 | % |
Source | Gene names |
---|---|
Sma3 | At5g37510; CHLREDRAFT_79362; EMB1467; GSVIVT00022315001; HAM_004; LOC_Os03g50540; MICPUCDRAFT_36280; MICPUN_64564; MPA22.5; NUOS1; OSJNBa0014G15.3; OSTLU_39049; Os03g0713400; OsI_13269; OsJ_12335; Ot12g00450; PHYPADRAFT_168248; PHYPADRAFT_205609; PHYPADRA |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | mitochondrial inner membrane | GO:0005743 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | respiratory chain complex I | GO:0045271 | Cellular Component | 0.0 | - |
Sma3 | actin binding | GO:0003779 | Molecular Function | 0.0 | - |
Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
Sma3 | NADH dehydrogenase (ubiquinone) activity | GO:0008137 | Molecular Function | 0.0 | - |
Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
Sma3 | iron-sulfur cluster binding | GO:0051536 | Molecular Function | 0.0 | - |
Sma3 | 2 iron, 2 sulfur cluster binding | GO:0051537 | Molecular Function | 0.0 | - |
Sma3 | 4 iron, 4 sulfur cluster binding | GO:0051539 | Molecular Function | 0.0 | - |
Sma3 | transport | GO:0006810 | Biological Process | 0.0 | - |
Sma3 | response to oxidative stress | GO:0006979 | Biological Process | 0.0 | - |
Sma3 | cytoskeleton organization | GO:0007010 | Biological Process | 0.0 | - |
Sma3 | photorespiration | GO:0009853 | Biological Process | 0.0 | - |
Sma3 | ATP synthesis coupled electron transport | GO:0042773 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | NADH:ubiquinone oxidoreductase, 75kDa subunit, conserved site | IPR000283 | - | 0.0 | - |
Sma3 | 2Fe-2S ferredoxin-type domain | IPR001041 | - | 0.0 | - |
Sma3 | 2Fe-2S ferredoxin, iron-sulphur binding site | IPR006058 | - | 0.0 | - |
Sma3 | Molybdopterin oxidoreductase | IPR006656 | - | 0.0 | - |
Sma3 | NADH:ubiquinone oxidoreductase, subunit G | IPR010228 | - | 0.0 | - |
Sma3 | Beta-grasp domain | IPR012675 | - | 0.0 | - |
Sma3 | NADH-quinone oxidoreductase, chain G, C-terminal | IPR015405 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G37510.2 | - | 4.0e-26 | 64% |
RefSeq | Arabidopsis thaliana | NP_851103.1 | NADH-ubiquinone oxidoreductase subunit [Arabidopsis thaliana] | 6.0e-26 | 64% |
RefSeq | Populus trichocarpa | XP_002302917.1 | predicted protein [Populus trichocarpa] | 1.0e-24 | 59% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LMM8
Fln msg: Distance to subject end: 378 aas, your sequence is shorter than subject: 81 - 750
Fln protein:
E
Protein Length:
82
Fln nts:
T
Fln Alignment:
F585NNT02JAC7V___ETVDVMDAVGSNIVVSMRTNEVMRILPKMNEDINEEWISDKTRFAYDGLKRQRLTAPFVKNDKGVLTQTDWEAAL
B8LMM8_______________ESIDVTDAVGSNIKIDSRGPEVMRILPRLNEDINEEWISDKTRFCYDGLKRQRLNEPMIRRPDGRLQPVTWHDAL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain