UniGene Name: sp_v3.0_unigene55671
Length: 241 nt
UniGene Fasta |
---|
>sp_v3.0_unigene55671
A |
Ace file of the UniGene sp_v3.0_unigene55671 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Nucleic acid binding protein, putative n=1 Tax=Ricinus communis RepID=B9RAP0_RICCO | - | - | 1.0e-23 | 58% |
FL-Next | sp=Lysine-specific demethylase REF6; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 66% |
Source | Gene names |
---|---|
Sma3 | B1417F08.20; GSVIVT00015901001; GSVIVT00018167001; JMJ901; Os01g0907400; OsI_04849; OsJ_04472; P0497A05.7; PHYPADRAFT_162343; PHYPADRAFT_167193; POPTRDRAFT_662091; POPTRDRAFT_725017; RCOM_0263520; RCOM_1507500; REF6; T29H11_50; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | response to brassinosteroid stimulus | GO:0009741 | Biological Process | 0.0 | - |
Sma3 | unidimensional cell growth | GO:0009826 | Biological Process | 0.0 | - |
Sma3 | vegetative to reproductive phase transition of meristem | GO:0010228 | Biological Process | 0.0 | - |
Sma3 | histone H3-K9 demethylation | GO:0033169 | Biological Process | 0.0 | - |
Sma3 | negative regulation of histone acetylation | GO:0035067 | Biological Process | 0.0 | - |
Sma3 | leaf development | GO:0048366 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | JmjC domain | IPR003347 | - | 0.0 | - |
Sma3 | Transcription factor jumonji, JmjN | IPR003349 | - | 0.0 | - |
Sma3 | Zinc finger, C2H2 | IPR007087 | - | 0.0 | - |
Sma3 | Zinc finger, C2H2-type/integrase, DNA-binding | IPR013087 | - | 0.0 | - |
Sma3 | IPR013129 | - | 0.0 | - | |
Sma3 | Zinc finger, C2H2-like | IPR015880 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G48430.1 | REF6 relative of early flowering 6 chr3:17935609-17940456 FORWARD LENGTH=1360 | 4.0e-26 | 66% |
RefSeq | Arabidopsis thaliana | NP_680116.2 | relative of early flowering 6 protein [Arabidopsis thaliana] | 5.0e-26 | 66% |
RefSeq | Populus trichocarpa | XP_002318104.1 | predicted protein [Populus trichocarpa] | 5.0e-29 | 67% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q9STM3
Fln msg: Distance to subject end: 60 aas, your sequence is shorter than subject: 80 - 1360
Fln protein:
S
Protein Length:
81
Fln nts:
A
Fln Alignment:
F585NNT02IKISG___DEKNGYRCDAEGCTMNFTSKQDLHLHKRNTCPIKGCGKHFISHKYLSHHRRVHLDDRPLTCPW
Q9STM3_______________EECAAYQCNMEGCTMSFSSEKQLMLHKRNICPIKGCGKNFFSHKYLVQHQRVHSDDRPLKCPW
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain