|
||||||
|
UniGene Name: sp_v3.0_unigene55339
Length: 163 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene55339
A |
|
Ace file of the UniGene sp_v3.0_unigene55339
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | RecName: Full=Cell division cycle protein 48 homolog; AltName: Full=Valosin-containing protein homolog; Short=VCP gb|AAA80587.1| valosin-containing protein [Glycine max] gb|ABC87759.1| plamsma membrane-associated AAA-ATPase [Glycine max] | - | - | 2.0e-08 | 63% |
| FL-Next | sp=Cell division cycle protein 48 homolog; Glycine max (Soybean) (Glycine hispida). | - | - | 0.0 | 63% |
| Source | Gene names |
|---|---|
| Sma3 | AT3G09840; At3g09840; CDC48; CDC48A; LOC_Os03g05730; LOC_Os10g30580; Os03g0151800; Os10g0442600; OsI_10049; OsI_33786; OsJ_09438; OsJ_31677; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
| Sma3 | nuclear envelope | GO:0005635 | Cellular Component | 0.0 | - |
| Sma3 | nucleolus | GO:0005730 | Cellular Component | 0.0 | - |
| Sma3 | spindle | GO:0005819 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | phragmoplast | GO:0009524 | Cellular Component | 0.0 | - |
| Sma3 | cytosolic ribosome | GO:0022626 | Cellular Component | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | nucleoside-triphosphatase activity | GO:0017111 | Molecular Function | 0.0 | - |
| Sma3 | identical protein binding | GO:0042802 | Molecular Function | 0.0 | - |
| Sma3 | cell cycle | GO:0007049 | Biological Process | 0.0 | - |
| Sma3 | pollen germination | GO:0009846 | Biological Process | 0.0 | - |
| Sma3 | pollen tube growth | GO:0009860 | Biological Process | 0.0 | - |
| Sma3 | protein transport | GO:0015031 | Biological Process | 0.0 | - |
| Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
| Sma3 | cell division | GO:0051301 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | CDC48, N-terminal subdomain | IPR003338 | - | 0.0 | - |
| Sma3 | AAA+ ATPase domain | IPR003593 | - | 0.0 | - |
| Sma3 | ATPase, AAA-type, core | IPR003959 | - | 0.0 | - |
| Sma3 | ATPase, AAA-type, conserved site | IPR003960 | - | 0.0 | - |
| Sma3 | CDC48, domain 2 | IPR004201 | - | 0.0 | - |
| Sma3 | ATPase, AAA-type, CDC48 | IPR005938 | - | 0.0 | - |
| Sma3 | Aspartate decarboxylase-like fold | IPR009010 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G03340.1 | ATPase, AAA-type, CDC48 protein chr5:810091-813133 REVERSE LENGTH=810 | 3.0e-11 | 59% |
| RefSeq | Arabidopsis thaliana | NP_568114.1 | cell division control protein 48-e [Arabidopsis thaliana] | 3.0e-11 | 59% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: P54774
Fln msg: Distance to subject end: 36 aas, your sequence is shorter than subject: 54 - 807
Fln protein:
M
Protein Length:
55
Fln nts:
A
Fln Alignment:
F51TW9002H91NC___PEAMDEDQLVRRYLKLKAAHFEEFHEVCSKERSADADIRKYQAFAQTLQQSR
P54774_______________PEAMDEDTVDDEVAEIKAAHFEESMKFARRSVS-DADIRKYQAFAQTLQQSR
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
