|
||||||
|
UniGene Name: sp_v3.0_unigene55320
Length: 210 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene55320
A |
|
Ace file of the UniGene sp_v3.0_unigene55320
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | biotin carboxylase [Stappia aggregata IAM 12614] gb|EAV41935.1| biotin carboxylase [Stappia aggregata IAM 12614] | - | - | 3.0e-12 | 76% |
| FL-Next | sp=Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial; Glycine max (Soybean) (Glycine hispida). | - | - | 0.0 | 73% |
| Sma3 | Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial | - | - | 4.065e-13 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Methylcrotonoyl-CoA carboxylase. | EC:6.4.1.4 | - | 1.486e-16 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Valine, leucine and isoleucine degradation | 00280 | 1.486e-16 | % | |
| Sma3 | Metabolic pathways | 01100 | 1.486e-16 | % |
| Source | Gene names |
|---|---|
| Sma3 | At1g03090; F10O3.9; F10O3_8; GSVIVT00023766001; LOC_Os12g41250; MCCA; Os12g0605800; OsI_39029; POPTRDRAFT_559591; RCOM_0646250; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | mitochondrial matrix | GO:0005759 | Cellular Component | 0.0 | - |
| Sma3 | cytosolic ribosome | GO:0022626 | Cellular Component | 0.0 | - |
| Sma3 | methylcrotonoyl-CoA carboxylase activity | GO:0004485 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | biotin binding | GO:0009374 | Molecular Function | 0.0 | - |
| Sma3 | ligase activity | GO:0016874 | Molecular Function | 0.0 | - |
| Sma3 | manganese ion binding | GO:0030145 | Molecular Function | 0.0 | - |
| Sma3 | leucine catabolic process | GO:0006552 | Biological Process | 0.0 | - |
| Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Biotin/lipoyl attachment | IPR000089 | - | 0.0 | - |
| Sma3 | Biotin-binding site | IPR001882 | - | 0.0 | - |
| Sma3 | Carbamoyl-phosphate synthetase, large subunit, ATP-binding | IPR005479 | - | 0.0 | - |
| Sma3 | Carbamoyl-phosphate synthase, large subunit, N-terminal | IPR005481 | - | 0.0 | - |
| Sma3 | Biotin carboxylase, C-terminal | IPR005482 | - | 0.0 | - |
| Sma3 | ATP-grasp fold | IPR011761 | - | 0.0 | - |
| Sma3 | Biotin carboxylation domain | IPR011764 | - | 0.0 | - |
| Sma3 | ATP-grasp fold, subdomain 2 | IPR013816 | - | 0.0 | - |
| Sma3 | IPR013817 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G03090.2 | MCCA methylcrotonyl-CoA carboxylase alpha chain, mitochondrial / 3-methylcrotonyl-CoA carboxylase 1 (MCCA) chr1:739715-743819 FORWARD LENGTH=734 | 2.0e-16 | 70% |
| RefSeq | Arabidopsis thaliana | NP_563674.1 | methylcrotonoyl-CoA carboxylase subunit alpha [Arabidopsis thaliana] | 3.0e-16 | 70% |
| RefSeq | Populus trichocarpa | XP_002307604.1 | predicted protein [Populus trichocarpa] | 7.0e-17 | 61% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q42777
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 507 aas, your sequence is shorter than subject: 47 - 731
Fln protein:
S
Protein Length:
48
Fln nts:
A
Fln Alignment:
F51TW9002JF2XA___AGVPVVPGYHGYEQDLDFLKEEADRIGYPILVKPARGGGGK
Q42777_______________AGVPLVPGYHGYDQDIEKMKLEADRIGYPVLIKPTHGGGGK
| SSRs (tot: 1) |
|---|
| Start position | End position | Sequence | Length |
|---|---|---|---|
| 113 | 125 | GTG GTG GTG GTG G | 13 |
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
