SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene55282

Length: 251 nt

UniGene Fasta

>sp_v3.0_unigene55282
ATGGGGGAAAAGTTAATTCTCTTTATTGACGAAATATATTTGGTTCTGGGTGCTGGGCGTACTGAGGGATCGATGGATGCTGCCAATTTATTTAAACCGATGCTTGCTCGGGGCCAACCTAGGTGCATTGGAGCAACTACTCTGGAAGAGTACAGGAAGTATGTGGAGAAAGATGGTGCGTTTGGGCGACGATTCCAGCAAGTTTATGTAGCCGAACCTAGTGTGACAGACACTATTAGTATCCTTCGTGG

Ace file of the UniGene sp_v3.0_unigene55282

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	101 kDa heat shock protein n=3 Tax=Solanaceae RepID=Q9ZT13_TOBAC	-	-	7.0e-34	92%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	93%
Sma3	Heat shock protein 101	-	-	2.907e-16	-

Source	Gene names
Sma3	AT4g14670; At1g74310; At2g25140; At3g48870; At5g15450; At5g50920; AtclpC; CD4A; CD4B; CHLREDRAFT_195417; CHLREDRAFT_195422; CHLREDRAFT_195423; CHLREDRAFT_195426; CLP2; CLPA; CLPB1; CLPB2; CLPB3; CLPC1; CLPC2; CLPD1; ClpC; ClpN; F1O17.2; GSVIVT00016219001;

Source	GOs	Term	Type	Identity
Sma3	cell wall	GO:0005618	Cellular Component	-
Sma3	mitochondrion	GO:0005739	Cellular Component	-
Sma3	chloroplast	GO:0009507	Cellular Component	-
Sma3	chloroplast thylakoid membrane	GO:0009535	Cellular Component	-
Sma3	chloroplast stroma	GO:0009570	Cellular Component	-
Sma3	Tic complex	GO:0031897	Cellular Component	-
Sma3	DNA binding	GO:0003677	Molecular Function	-
Sma3	ATP-dependent peptidase activity	GO:0004176	Molecular Function	-
Sma3	nuclease activity	GO:0004518	Molecular Function	-
Sma3	protein binding	GO:0005515	Molecular Function	-
Sma3	ATP binding	GO:0005524	Molecular Function	-
Sma3	peptidase activity	GO:0008233	Molecular Function	-
Sma3	nucleoside-triphosphatase activity	GO:0017111	Molecular Function	-
Sma3	nucleotide-excision repair	GO:0006289	Biological Process	-
Sma3	response to stress	GO:0006950	Biological Process	-
Sma3	response to heat	GO:0009408	Biological Process	-
Sma3	response to high light intensity	GO:0009644	Biological Process	-
Sma3	chloroplast organization	GO:0009658	Biological Process	-
Sma3	regulation of chlorophyll biosynthetic process	GO:0010380	Biological Process	-
Sma3	protein metabolic process	GO:0019538	Biological Process	-
Sma3	response to hydrogen peroxide	GO:0042542	Biological Process	-
Sma3	protein unfolding	GO:0043335	Biological Process	-
Sma3	protein import into chloroplast stroma	GO:0045037	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	GPCR, rhodopsin-like, 7TM	IPR000276	-	-
Sma3	Chaperonin ClpA/B	IPR001270	-	-
Sma3	UVR domain	IPR001943	-	-
Sma3	AAA+ ATPase domain	IPR003593	-	-
Sma3	ATPase, AAA-type, core	IPR003959	-	-
Sma3	Clp, N-terminal	IPR004176	-	-
Sma3	TonB box, conserved site	IPR010916	-	-
Sma3	ATPase, AAA-2	IPR013093	-	-
Sma3	Chaperonin ClpB	IPR017730	-	-
Sma3	EF-Hand 1, calcium-binding site	IPR018247	-	-
Sma3	Chaperonin ClpA/B, conserved site	IPR018368	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT1G74310.1	ATHSP101, HSP101, HOT1 heat shock protein 101 chr1:27936715-27939862 REVERSE LENGTH=911	4.00001e-41	91%
RefSeq	Arabidopsis thaliana	NP_565083.1	heat shock protein 101 [Arabidopsis thaliana]	4.99997e-41	91%
RefSeq	Populus trichocarpa	XP_002328643.1	predicted protein [Populus trichocarpa]	1.99993e-41	92%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: B8LQS4

Fln msg: Distance to subject end: 110 aas, your sequence is shorter than subject: 83 - 463

Fln protein: MGEKLILFIDEIYLVLGAGRTEGSMDAANLFKPMLARGQPRCIGATTLEEYRKYVEKDGAFGRRFQQVYVAEPSVTDTISILR

Protein Length: 84

Fln nts: ATGGGGGAAAAGTTAATTCTCTTTATTGACGAAATATATTTGGTTCTGGGTGCTGGGCGTACTGAGGGATCGATGGATGCTGCCAATTTATTTAAACCGATGCTTGCTCGGGGCCAACCTAGGTGCATTGGAGCAACTACTCTGGAAGAGTACAGGAAGTATGTGGAGAAAGATGGTGCGTTTGGGCGACGATTCCAGCAAGTTTATGTAGCCGAACCTAGTGTGACAGACACTATTAGTATCCTTCGTGG

Fln Alignment:

F51TW9002IARF8___KLILFIDEIYLVLGAGRTEGSMDAANLFKPMLARGQPRCIGATTLEEYRKYVEKDGAFGRRFQQVYVAEPSVTDTISILR
B8LQS4_______________KVILFIDEIHLVLGAGRTEGSMDAANLFKPMLARGQLRCIGATTLEEYRKYVEKDAAFERRFQQVYVAEPSVTDTISILR

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain