UniGene Name: sp_v3.0_unigene54959
Length: 130 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene54959
A |
Ace file of the UniGene sp_v3.0_unigene54959 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | ATP synthase subunit alpha, chloroplastic n=23 Tax=Embryophyta RepID=ATPA_ANGEV | - | - | 5.0e-14 | 100% |
| FL-Next | sp=ATP synthase subunit alpha, chloroplastic; Taiwania cryptomerioides. Plastid; Chloroplast. | - | - | 0.0 | 97% |
| Sma3 | F-ATPase subunit alpha | - | - | 0.0 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | H(+)-transporting two-sector ATPase. | EC:3.6.3.14 | - | 1.36e-20 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Oxidative phosphorylation | 00190 | 1.36e-20 | % | |
| Sma3 | Photosynthesis | 00195 | 1.36e-20 | % | |
| Sma3 | Methane metabolism | 00680 | 1.36e-20 | % | |
| Sma3 | Metabolic pathways | 01100 | 1.36e-20 | % |
| Source | Gene names |
|---|---|
| Sma3 | CLPGMS-2208; GSVIVT00035586001; Grc000146; Heak293_Cp081; LOC_Os10g21240; LOC_Os10g38270; OSJNAb0075K12.16; OSJNBa0061C08.5; OSJNBb0005J14.21; OSJNBb0075K12.32; OtCpg00470; POPTRDRAFT_278454; POPTRDRAFT_292334; atp alpha; atp1; atpA; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | plastid | GO:0009536 | Cellular Component | 0.0 | - |
| Sma3 | thylakoid | GO:0009579 | Cellular Component | 0.0 | - |
| Sma3 | cyanelle | GO:0009842 | Cellular Component | 0.0 | - |
| Sma3 | plastid membrane | GO:0042170 | Cellular Component | 0.0 | - |
| Sma3 | proton-transporting ATP synthase complex, catalytic core F(1) | GO:0045261 | Cellular Component | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | hydrogen ion transporting ATP synthase activity, rotational mechanism | GO:0046933 | Molecular Function | 0.0 | - |
| Sma3 | proton-transporting ATPase activity, rotational mechanism | GO:0046961 | Molecular Function | 0.0 | - |
| Sma3 | ATP synthesis coupled proton transport | GO:0015986 | Biological Process | 0.0 | - |
| Sma3 | plasma membrane ATP synthesis coupled proton transport | GO:0042777 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | ATPase, F1/V1/A1 complex, alpha/beta subunit, nucleotide-binding domain | IPR000194 | - | 0.0 | - |
| Sma3 | ATPase, F1/V1/A1 complex, alpha/beta subunit, C-terminal | IPR000793 | - | 0.0 | - |
| Sma3 | ATPase, F1/V1/A1 complex, alpha/beta subunit, N-terminal | IPR004100 | - | 0.0 | - |
| Sma3 | ATPase, F1 complex, alpha subunit | IPR005294 | - | 0.0 | - |
| Sma3 | IPR017458 | - | 0.0 | - | |
| Sma3 | HerA-ATP synthase, barrel domain | IPR018538 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | ATCG00120.1 | ATPA ATP synthase subunit alpha chrC:9938-11461 REVERSE LENGTH=507 | 6.0e-19 | 97% |
| RefSeq | Arabidopsis thaliana | NP_085571.2 | ATPase subunit 1 (mitochondrion) [Arabidopsis thaliana] | 8.0e-16 | 91% |
| RefSeq | Populus trichocarpa | XP_002332596.1 | predicted protein, partial [Populus trichocarpa] | 5.0e-19 | 94% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: G4LAU0
Fln msg: Distance to subject end: 211 aas, your sequence is shorter than subject: 43 - 504
Fln protein:
K
Protein Length:
44
Fln nts:
A
Fln Alignment:
F51TW9001DOBL8___KQHTLIIYDDLSKQAQAYRQMSLLLRRPPGREAYPGDV
G4LAU0_______________EQHTLIIYDDLSKQAQAYRQMSLLLRRPPGREAYPGDV

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta (sense)