SustainPineDB

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene54911

Length: 413 nt

UniGene Fasta

Ace file of the UniGene sp_v3.0_unigene54911

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Polyubiquitin 4 UBQ4 n=1 Tax=Arabidopsis thaliana RepID=Q0WRN6_ARATH	-	-	0.0	99%
FL-Next	tr=Polyubiquitin; Pinus sylvestris (Scots pine).	-	-	0.0	99%
Sma3	Polyubiquitin	-	-	9.14e-08	-

Source	Gene names
Sma3	AT5G03240; At1g55060; At2g36170; At3g09790; At4g02890; At4g05050; At4g05320; At5g03240; At5g20620; At5g37640; B1472F02.6; CHLREDRAFT_140045; EgUbi; F11F8_38; F8A24.16; FUBI1; GSVIVT00035709001; GSVIVT00037199001; GUbB1; GUbB2; H0303G06.8; LOC_Os03g13170;

Source	GOs	Term	Type	Identity
Sma3	cell wall	GO:0005618	Cellular Component	-
Sma3	nucleolus	GO:0005730	Cellular Component	-
Sma3	vacuole	GO:0005773	Cellular Component	-
Sma3	ribosome	GO:0005840	Cellular Component	-
Sma3	plasma membrane	GO:0005886	Cellular Component	-
Sma3	structural constituent of ribosome	GO:0003735	Molecular Function	-
Sma3	protein modification process	GO:0006464	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Ubiquitin	IPR000626	-	-
Sma3	Ribosomal protein L40e	IPR001975	-	-
Sma3	Ribosomal protein S27a	IPR002906	-	-
Sma3	Isocitrate lyase/phosphorylmutase, conserved site	IPR018523	-	-

Source	Species	ID	Description	Identity
ATG	Arabidoptis thaliana	AT4G05320.2	UBQ10 polyubiquitin 10 chr4:2718559-2719932 FORWARD LENGTH=457	99%
RefSeq	Arabidopsis thaliana	NP_849301.4	polyubiquitin 10 [Arabidopsis thaliana]	99%
RefSeq	Populus trichocarpa	XP_002299930.1	predicted protein [Populus trichocarpa]	99%

Full-Lengther Next Prediction

Fln status: Putative Complete

Fln database: coniferopsida.fasta

Fln subject: Q41067

Fln msg: ERROR#3, very serious frame error, warning!, putative chimeric sequence! or repetitive structure STOP codon was not found. Distance to subject end: 1 aas, atg_distance in limit (1-15): atg_distance = 1, W2: There is no M at the beginning, your sequence is shorter than subject: 137 - 761

Fln protein: DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIxxxxTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTI

Protein Length: 138

Fln nts: CGACCAGCAGAGGCTGATCTTTGCTGGAAAACAGCTCGAGGACGGACGCACTCTCGCAGATTACAACATCCAGAAGGAATCGACTCTTCACCTTGTTCTCCGTCTCAGAGGAGGGATGCAGATCTTTGTTAAAACCCTGACTGGAAAAACTATCACGCTTGAAGTTGAGAGCTCAGACACTATTGACAACGTCAAGGCCAAAATTCAAGATAAGGAGGGGATTCCTCCGGATCAGCAGAGATTGATCTTTGCAGGGAAGCAACTTGAAGATGGCAGGACTCTAGCCGACTACAACATTxxxxxxxxxxxxACGCTGCATCTTGTCCTTCGCCTCCGTGGTGGTATGCAGATATTTGTGAAGACATTGACGGGCAAGACAATCACACTAGAGGTTGAGAGCTCTGATACGATTGA___

Fln Alignment:

F5X2MQL01EHIPU___xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
Q41067_______________xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain