|
||||||
|
UniGene Name: sp_v3.0_unigene54903
Length: 185 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene54903
A |
|
Ace file of the UniGene sp_v3.0_unigene54903
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Dtdp-glucose 4-6-dehydratase, putative n=1 Tax=Ricinus communis RepID=B9T734_RICCO | - | - | 2.0e-14 | 86% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 79% |
| Sma3 | UDP-glucuronic acid decarboxylase | - | - | 1.341e-21 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | UDP-glucuronate decarboxylase. | EC:4.1.1.35 | - | 1.095e-20 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Starch and sucrose metabolism | 00500 | 1.095e-20 | % | |
| Sma3 | Amino sugar and nucleotide sugar metabolism | 00520 | 1.095e-20 | % | |
| Sma3 | Metabolic pathways | 01100 | 1.095e-20 | % |
| Source | Gene names |
|---|---|
| Sma3 | AT2G47650; At3g53520; At3g62830; B1012D10.32; CHLREDRAFT_135101; D18; F26K9_260; F4P12.220; F4P12_220; GAD1; GSVIVT00023112001; GSVIVT00028008001; GSVIVT00033009001; LOC_Os03g17230; OSTLU_43376; Os01g0315800; Os01g0837300; Os03g0280800; Os05g0363200; Os07 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Golgi membrane | GO:0000139 | Cellular Component | 0.0 | - |
| Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
| Sma3 | Golgi apparatus | GO:0005794 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | catalytic activity | GO:0003824 | Molecular Function | 0.0 | - |
| Sma3 | UDP-glucuronate decarboxylase activity | GO:0048040 | Molecular Function | 0.0 | - |
| Sma3 | coenzyme binding | GO:0050662 | Molecular Function | 0.0 | - |
| Sma3 | D-xylose metabolic process | GO:0042732 | Biological Process | 0.0 | - |
| Sma3 | cellular metabolic process | GO:0044237 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | NAD-dependent epimerase/dehydratase | IPR001509 | - | 0.0 | - |
| Sma3 | NAD(P)-binding domain | IPR016040 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G62830.1 | UXS2, ATUXS2, AUD1 NAD(P)-binding Rossmann-fold superfamily protein chr3:23232539-23235353 FORWARD LENGTH=445 | 9.0e-15 | 75% |
| RefSeq | Arabidopsis thaliana | NP_850694.2 | UDP-glucuronic acid decarboxylase 1 [Arabidopsis thaliana] | 2.0e-15 | 81% |
| RefSeq | Populus trichocarpa | XP_002323432.1 | predicted protein [Populus trichocarpa] | 3.0e-16 | 86% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NUL8
Fln msg: Overlapping hits, possible frame ERROR between 74 and 73, Distance to subject end: 30 aas, your sequence is shorter than subject: 61 - 417
Fln protein:
G
Protein Length:
62
Fln nts:
A
Fln Alignment:
F5X2MQL01CSNDJ___GLIRLMESNHIFGYLFNLGNPGExTMLELAQVVKETIDSTARIEYKENTADDPHKRKPDI
A9NUL8_______________GLIRLMESNHVGP--FNLGNPGExTMLELAEVVKETIDSNAKIEFKENTADDPHKRKPDI
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
