SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene54733

Length: 484 nt

This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense

UniGene Fasta (sense)

>sp_v3.0_unigene54733
ATGGGGAGTGAGGCAATTAGGTGCAACTTCAATGGATGGGCAGTCAGATAGAGATGGGGATCTTAGTTTTCAGCCAACAGCGGGTTCTGCAGTCTCTGCATTCCAACATTTGGAACAGGCTCCAGAGGATCCGATTCTTGGGGTGACAGTTGCCTATAACAAGGATCCGAGCCCTGTGAAATTGAATTTGGGTGTTGGGGCGTATCGAACTGAGGTAATGTTTTACACTTTTACTATAAATCGGTTATTAATATGGATACATAGATCTTTATATGAATTGTATATCTGACTGGATATGAAGCAGTGTTACAAACCCTGTTGTTTACCTAGACTCGTGCGTCAAATCGGGCTTAGTCCAAAAATGAGGCAAAATTAATTTGGTGGTGAGGCAAATTCACAGCCAATAAGTCTCACTCGTGACTCGTCGTGAGTACTTGTGGGTGGGCCAAGTTTCCCAGAGTCTGAATTTCCTCTTATATTATTA

Ace file of the UniGene sp_v3.0_unigene54733 (antisense)

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Aspartate aminotransferase n=8 Tax=Pinaceae RepID=C0PSV4_PICSI	-	-	4.0e-30	75%
FL-Next	sp=Aspartate aminotransferase; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	75%
Sma3	Aspartate aminotransferase	-	-	1.03e-28	-

Source	ECs	Term	Type	e value	Identity
Sma3	Aspartate transaminase.	EC:2.6.1.1	-	0.0	-

Source	KEGGs	Term	Identity
Sma3	Alanine, aspartate and glutamate metabolism	00250	%
Sma3	Cysteine and methionine metabolism	00270	%
Sma3	Arginine and proline metabolism	00330	%
Sma3	Tyrosine metabolism	00350	%
Sma3	Phenylalanine metabolism	00360	%
Sma3	Phenylalanine, tyrosine and tryptophan biosynthesis	00400	%
Sma3	Carbon fixation in photosynthetic organisms	00710	%
Sma3	Isoquinoline alkaloid biosynthesis	00950	%
Sma3	Tropane, piperidine and pyridine alkaloid biosynthesis	00960	%
Sma3	Biosynthesis of phenylpropanoids	01061	%
Sma3	Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid	01064	%
Sma3	Biosynthesis of plant hormones	01070	%
Sma3	Metabolic pathways	01100	%
Sma3	Biosynthesis of secondary metabolites	01110	%

Source	Gene names
Sma3	AAT; AAT-1; AAT-P1; ASP2; ASP3; At5g11520; At5g19550; F15N18_110; GSVIVT00016723001; GSVIVT00032463001; Os01g0760600; OsI_03821; OsJ_03530; PHYPADRAFT_136815; POPTRDRAFT_819551; POPTRDRAFT_835881; RCOM_0802970; RCOM_1052360; T20D1.70; VITISV_020521; pcAAT

Source	GOs	Term	Type	Identity
Sma3	cell wall	GO:0005618	Cellular Component	-
Sma3	cytoplasm	GO:0005737	Cellular Component	-
Sma3	peroxisome	GO:0005777	Cellular Component	-
Sma3	cytosol	GO:0005829	Cellular Component	-
Sma3	plasma membrane	GO:0005886	Cellular Component	-
Sma3	chloroplast	GO:0009507	Cellular Component	-
Sma3	membrane	GO:0016020	Cellular Component	-
Sma3	L-aspartate:2-oxoglutarate aminotransferase activity	GO:0004069	Molecular Function	-
Sma3	transaminase activity	GO:0008483	Molecular Function	-
Sma3	pyridoxal phosphate binding	GO:0030170	Molecular Function	-
Sma3	cellular amino acid metabolic process	GO:0006520	Biological Process	-
Sma3	biosynthetic process	GO:0009058	Biological Process	-
Sma3	leaf senescence	GO:0010150	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Aspartate/other aminotransferase	IPR000796	-	-
Sma3	Aminotransferases, class-I, pyridoxal-phosphate-binding site	IPR004838	-	-
Sma3	Aminotransferase, class I/classII	IPR004839	-	-
Sma3	Pyridoxal phosphate-dependent transferase, major region, subdomain 1	IPR015421	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT5G11520.1	ASP3, YLS4 aspartate aminotransferase 3 chr5:3685257-3687721 REVERSE LENGTH=449	5.0e-19	64%
RefSeq	Arabidopsis thaliana	NP_196713.1	aspartate aminotransferase [Arabidopsis thaliana]	6.0e-19	64%
RefSeq	Populus trichocarpa	XP_002308618.1	predicted protein [Populus trichocarpa]	8.0e-19	65%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: C0PSV4

Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 269 aas, your sequence is shorter than subject: 96 - 462

Fln protein: WGVRQLGATSMDGQSDRDGDLSFQPTAGSAVSAFQHLEQAPEDPILGVTVAYNKDPSPVKLNLGVGAYRTEVMFYTFTINRLLIWIHRSLYELYI*

Protein Length: 97

Fln nts: ATGGGGAGTGAGGCAATTAGGTGCAACTTCAATGGATGGGCAGTCAGATAGAGATGGGGATCTTAGTTTTCAGCCAACAGCGGGTTCTGCAGTCTCTGCATTCCAACATTTGGAACAGGCTCCAGAGGATCCGATTCTTGGGGTGACAGTTGCCTATAACAAGGATCCGAGCCCTGTGAAATTGAATTTGGGTGTTGGGGCGTATCGAACTGAGGTAATGTTTTACACTTTTACTATAAATCGGTTATTAATATGGATACATAGATCTTTATATGAATTGTATATCTGACTGGATATGAAGCAGTGTTACAAACCCTGTTGTTTACCTAGACTCGTGCGTCAAATCGGGCTTAGTCCAAAAATGAGGCAAAATTAATTTGGTGGTGAGGCAAATTCACAGCCAATAAGTCTCACTCGTGACTCGTCGTGAGTACTTGTGGGTGGGCCAAGTTTCCCAGAGTCTGAATTTCCTCTTATATTATTA

Fln Alignment:

F5X2MQL01D0DWO___VRQLGATSMDGQSDRDGDLSFQPTAGSAVSAFQHLEQAPEDPILGVTVAYNKDPSPVKLNLGVGAYRTE-----VMFYTFTINRLLIWIHRSLYELYI
C0PSV4_______________VRQLAATSMEGQADRDGDLRFQPTAGSAVSAFQHLEQAPEDPILGVTVAYNKDPSPVKLNLGVGAYRTEEGKPLVLDVVRQAEELLIQ-DRSRYKEYI

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain