UniGene Name: sp_v3.0_unigene54634
Length: 208 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene54634
C |
Ace file of the UniGene sp_v3.0_unigene54634
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | pfam01363, FYVE, FYVE zinc finger | - | - | 9.0e-18 | 45% |
| FL-Next | tr=Putative ZR1 protein; Oryza sativa subsp. japonica (Rice). | - | - | 0.0 | 67% |
| Sma3 | Ran GTPase binding protein, putative | - | - | 4.093e-16 | - |
| Source | Gene names |
|---|---|
| Sma3 | AT4g14370; At1g76950; At4g14370; At5g12350; At5g19420; At5g42140; F22K20.5; GSVIVT00002262001; GSVIVT00020277001; GSVIVT00022255001; GSVIVT00030935001; H0723C07.10; OJ1206_C08.13; OJ1345_B12.1; OJ1354_D07.10; OSJNBa0070M12.5; Os01g0700200; Os01g0952300; O |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | intrinsic to membrane | GO:0031224 | Cellular Component | 0.0 | - |
| Sma3 | transmembrane signaling receptor activity | GO:0004888 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | nucleoside-triphosphatase activity | GO:0017111 | Molecular Function | 0.0 | - |
| Sma3 | apoptotic process | GO:0006915 | Biological Process | 0.0 | - |
| Sma3 | signal transduction | GO:0007165 | Biological Process | 0.0 | - |
| Sma3 | innate immune response | GO:0045087 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Toll/interleukin-1 receptor homology (TIR) domain | IPR000157 | - | 0.0 | - |
| Sma3 | Peptidase S8/S53, subtilisin/kexin/sedolisin | IPR000209 | - | 0.0 | - |
| Sma3 | Zinc finger, FYVE-type | IPR000306 | - | 0.0 | - |
| Sma3 | Regulator of chromosome condensation, RCC1 | IPR000408 | - | 0.0 | - |
| Sma3 | Leucine-rich repeat | IPR001611 | - | 0.0 | - |
| Sma3 | Pleckstrin homology domain | IPR001849 | - | 0.0 | - |
| Sma3 | NB-ARC | IPR002182 | - | 0.0 | - |
| Sma3 | AAA+ ATPase domain | IPR003593 | - | 0.0 | - |
| Sma3 | Endonuclease/exonuclease/phosphatase | IPR005135 | - | 0.0 | - |
| Sma3 | Regulator of chromosome condensation/beta-lactamase-inhibitor protein II | IPR009091 | - | 0.0 | - |
| Sma3 | Leucine-rich repeat 3 | IPR011713 | - | 0.0 | - |
| Sma3 | Pleckstrin homology-like domain | IPR011993 | - | 0.0 | - |
| Sma3 | Brevis radix-like domain | IPR013591 | - | 0.0 | - |
| Sma3 | Zinc finger, FYVE-related | IPR017455 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G19420.2 | - | 1.0e-25 | 60% |
| RefSeq | Arabidopsis thaliana | NP_197443.3 | regulator of chromosome condensation-like protein with FYVE zinc finger domain [Arabidopsis thaliana] | 2.0e-25 | 60% |
| RefSeq | Populus trichocarpa | XP_002313993.1 | predicted protein [Populus trichocarpa] | 8.0e-25 | 62% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: tr_plants
Fln subject: Q5JL00
Fln msg: Distance to subject end: 357 aas, your sequence is shorter than subject: 68 - 1091
Fln protein:
M
Protein Length:
69
Fln nts:
C
Fln Alignment:
F51TW9002J34B8___MCSGCRQSFGLTRKRHSCHHCGLVYCHSCSHKKVMKAAFPPNTNKTYRVCHACYLKLNKGLETST
Q5JL00_______________MCSGCRQPFNLRRKRHNCYNCALVFCHSCSSKKSLKASLAPNPNKPYRVCDSCYSKLTKGLETDT

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta