|
||||||
|
UniGene Name: sp_v3.0_unigene54623
Length: 220 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene54623
G |
|
Ace file of the UniGene sp_v3.0_unigene54623
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Tau class glutathione S-transferase n=2 Tax=Pinus RepID=D3YLT8_9CONI | - | - | 6.0e-20 | 94% |
| FL-Next | tr=Tau class glutathione S-transferase; Pinus brutia. | - | - | 0.0 | 96% |
| Sma3 | Glutathione S-transferase | - | - | 2.162e-32 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Glutathione transferase. | EC:2.5.1.18 | - | 1.036e-31 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Glutathione metabolism | 00480 | 1.036e-31 | % | |
| Sma3 | Metabolism of xenobiotics by cytochrome P450 | 00980 | 1.036e-31 | % | |
| Sma3 | Drug metabolism - cytochrome P450 | 00982 | 1.036e-31 | % | |
| Sma3 | Lactoylglutathione lyase. | EC:4.4.1.5 | - | 1.382e-33 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Pyruvate metabolism | 00620 | 1.382e-33 | % |
| Source | Gene names |
|---|---|
| Sma3 | At1g17170; At1g17180; At1g17180/F20D23_12; At1g17190; At1g53680; At1g59700; At1g74590; At1g74590/F1M20_27; At1g78320; At1g78340; At1g78340/F3F9_13; At1g78360; At1g78370; At1g78380; BI-GST/GPX; C-7; F1M20.27; F20D23.11; F20D23.12; F20D23.13; F22G10.22; F23 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast stroma | GO:0009570 | Cellular Component | 0.0 | - |
| Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
| Sma3 | glutathione transferase activity | GO:0004364 | Molecular Function | 0.0 | - |
| Sma3 | lactoylglutathione lyase activity | GO:0004462 | Molecular Function | 0.0 | - |
| Sma3 | peroxidase activity | GO:0004601 | Molecular Function | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | transferase activity | GO:0016740 | Molecular Function | 0.0 | - |
| Sma3 | glutathione binding | GO:0043295 | Molecular Function | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | response to oxidative stress | GO:0006979 | Biological Process | 0.0 | - |
| Sma3 | toxin catabolic process | GO:0009407 | Biological Process | 0.0 | - |
| Sma3 | response to cold | GO:0009409 | Biological Process | 0.0 | - |
| Sma3 | response to herbicide | GO:0009635 | Biological Process | 0.0 | - |
| Sma3 | auxin mediated signaling pathway | GO:0009734 | Biological Process | 0.0 | - |
| Sma3 | cellular response to water deprivation | GO:0042631 | Biological Process | 0.0 | - |
| Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
| Sma3 | Lipocalin | IPR002345 | - | 0.0 | - |
| Sma3 | Gnk2-homologous domain | IPR002902 | - | 0.0 | - |
| Sma3 | Glutathione S-transferase, N-terminal | IPR004045 | - | 0.0 | - |
| Sma3 | Glutathione S-transferase, C-terminal | IPR004046 | - | 0.0 | - |
| Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
| Sma3 | Glutathione S-transferase, C-terminal-like | IPR010987 | - | 0.0 | - |
| Sma3 | IPR012335 | - | 0.0 | - | |
| Sma3 | IPR017442 | - | 0.0 | - | |
| Sma3 | Glutathione S-transferase/chloride channel, C-terminal | IPR017933 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G78340.1 | ATGSTU22, GSTU22 glutathione S-transferase TAU 22 chr1:29473046-29473797 REVERSE LENGTH=218 | 3.0e-17 | 68% |
| RefSeq | Arabidopsis thaliana | NP_177956.1 | glutathione S-transferase TAU 22 [Arabidopsis thaliana] | 4.0e-17 | 68% |
| RefSeq | Populus trichocarpa | XP_002300483.1 | predicted protein [Populus trichocarpa] | 2.0e-18 | 72% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D3YLT8
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 134 aas, your sequence is shorter than subject: 68 - 228
Fln protein:
G
Protein Length:
69
Fln nts:
G
Fln Alignment:
F51TW9002I12R8___GLEEKGVKYEYQEENLAPKSELLLKMNPIHKKIPVLIHDDKPVLESLIIVE
D3YLT8_______________GLEEKGVKYEYQEENLASKSELLLKMNPIHKKIPVLIHNDKPVLESLIIVE
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
