UniGene Name: sp_v3.0_unigene54387
Length: 173 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense) |
---|
>sp_v3.0_unigene54387
T |
Ace file of the UniGene sp_v3.0_unigene54387 (antisense) |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Reverse transcriptase (Fragment) n=1 Tax=Taxus baccata RepID=Q56GF5_TAXBA | - | - | 3.0e-13 | 80% |
FL-Next | sp=RNA-directed DNA polymerase homolog; berteroana). Mitochondrion. | - | - | 0.0 | 68% |
Sma3 | Retrotransposon protein, putative, unclassified | - | - | 6.473e-09 | - |
Source | Gene names |
---|---|
Sma3 | LOC_Os03g30350; LOC_Os03g47840; LOC_Os10g13960; LOC_Os10g28310; LOC_Os11g08610; LOC_Os12g15780; OJ1004_F02.14; OSIGBa0118P15.5; OSJNBa0004L19.22; OSJNBa0014J14.7; OSJNBa0053B21.11; OSJNBb0056B16.5; OSJNBb0059G13.28; OSJNBb0070O09.8; Os01g0640000; Os04g031 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | chromatin | GO:0000785 | Cellular Component | 0.0 | - |
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | chromatin binding | GO:0003682 | Molecular Function | 0.0 | - |
Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
Sma3 | carbonate dehydratase activity | GO:0004089 | Molecular Function | 0.0 | - |
Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | sugar binding | GO:0005529 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
Sma3 | chromatin assembly or disassembly | GO:0006333 | Biological Process | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
Sma3 | carbon utilization | GO:0015976 | Biological Process | 0.0 | - |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: P31843
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 43 aas, your sequence is shorter than subject: 57 - 142
Fln protein:
S
Protein Length:
58
Fln nts:
T
Fln Alignment:
F51TW9001CL3E2___DIPKTTFRCHYGHFEFLVMPFGLTNTLATFQLCMN
P31843_______________DEPKTTCVTRYGSFEFRVMPFGLTNALATFCNLMN
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain