UniGene Name: sp_v3.0_unigene54150
Length: 108 nt
UniGene Fasta |
---|
>sp_v3.0_unigene54150
G |
Ace file of the UniGene sp_v3.0_unigene54150 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Os07g0528100 protein (Fragment) n=3 Tax=Oryza sativa Japonica Group RepID=Q0D5X2_ORYSJ | - | - | 1.0e-07 | 74% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 65% |
Source | Gene names |
---|---|
Sma3 | 60I2G14; B1110B01.4; F19K19.5; F28G4.2; LOC_Os10g04074; MtrDRAFT_AC147431g15v2; MtrDRAFT_AC147431g58v2; MtrDRAFT_AC149577g2v1; OSIGBa0115A19.5; OSJNAb0072F04.11; OSJNBa0029L02.7; OSJNBb0072F04.17; Os07g0528100; Os10g0130700; RT; SDM1_42t00018; SDM1_46t000 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | CCAAT-binding factor complex | GO:0016602 | Cellular Component | 0.0 | - |
Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | sequence-specific DNA binding transcription factor activity | GO:0003700 | Molecular Function | 0.0 | - |
Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | sugar binding | GO:0005529 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | apoptotic process | GO:0006915 | Biological Process | 0.0 | - |
Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LKV8
Fln msg: Distance to subject end: 281 aas, your sequence is shorter than subject: 35 - 363
Fln protein:
A
Protein Length:
36
Fln nts:
G
Fln Alignment:
F5X2MQL01BTXHI___ARLVAKGYAQQEGIDYEDTFAPVAKLNTIRLLIAL
B8LKV8_______________ARLVAKGFAQEYGVDYNETFAPVARLDTIRMVLAI
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain