UniGene Name: sp_v3.0_unigene54141
Length: 100 nt
UniGene Fasta |
---|
>sp_v3.0_unigene54141
A |
Ace file of the UniGene sp_v3.0_unigene54141 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | R2R3-MYB transcription factor n=1 Tax=Pinus taeda RepID=Q6V0J3_PINTA | - | - | 2.0e-09 | 83% |
FL-Next | tr=R2R3-MYB transcription factor; Pinus taeda (Loblolly pine). | - | - | 0.0 | 83% |
Sma3 | MYB transcription factor | - | - | 5.606e-10 | - |
Source | Gene names |
---|---|
Sma3 | At1g09540; At1g63910; At3g08500; At3g13890; At3g48920; At4g01680; At4g01680/T15B16.4; At4g34990; At5g12870; At5g26660; F14J9.20; F21E10.4; GSVIVT00002546001; GSVIVT00010499001; GSVIVT00016004001; GSVIVT00019744001; GSVIVT00021123001; GSVIVT00022504001; GS |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | sequence-specific DNA binding transcription factor activity | GO:0003700 | Molecular Function | 0.0 | - |
Sma3 | specific transcriptional repressor activity | GO:0016566 | Molecular Function | 0.0 | - |
Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
Sma3 | response to UV | GO:0009411 | Biological Process | 0.0 | - |
Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
Sma3 | phenylpropanoid biosynthetic process | GO:0009699 | Biological Process | 0.0 | - |
Sma3 | response to ethylene stimulus | GO:0009723 | Biological Process | 0.0 | - |
Sma3 | response to abscisic acid stimulus | GO:0009737 | Biological Process | 0.0 | - |
Sma3 | response to salicylic acid stimulus | GO:0009751 | Biological Process | 0.0 | - |
Sma3 | response to jasmonic acid stimulus | GO:0009753 | Biological Process | 0.0 | - |
Sma3 | secondary cell wall biogenesis | GO:0009834 | Biological Process | 0.0 | - |
Sma3 | GO:0045449 | Biological Process | 0.0 | - | |
Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | SANT/Myb domain | IPR001005 | - | 0.0 | - |
Sma3 | IPR012287 | - | 0.0 | - | |
Sma3 | IPR014778 | - | 0.0 | - | |
Sma3 | Myb transcription factor | IPR015495 | - | 0.0 | - |
Sma3 | Myb-like domain | IPR017877 | - | 0.0 | - |
Sma3 | Myb domain, DNA-binding | IPR017930 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G12870.1 | ATMYB46, MYB46 myb domain protein 46 chr5:4062939-4064939 REVERSE LENGTH=280 | 3.0e-14 | 80% |
RefSeq | Arabidopsis thaliana | NP_001118913.1 | myb domain protein 55 [Arabidopsis thaliana] | 4.0e-14 | 80% |
RefSeq | Populus trichocarpa | XP_002313334.1 | predicted protein, partial [Populus trichocarpa] | 1.0e-14 | 80% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: Q6V0J3
Fln msg: Distance to subject end: 244 aas, your sequence is shorter than subject: 32 - 314
Fln protein:
G
Protein Length:
33
Fln nts:
A
Fln Alignment:
F5X2MQL01CILLL___GMGCWNYIAEQAGLQRCGKSCRLRWINYLRP
Q6V0J3_______________GQGCWSDVAKQAGLQRCGKSCRLRWINYLRP
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain