|
||||||
|
UniGene Name: sp_v3.0_unigene53964
Length: 165 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
 UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene53964
A |
|
Ace file of the UniGene sp_v3.0_unigene53964 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Pentatricopeptide repeat protein 45 n=2 Tax=Funariaceae RepID=F5CAE4_FUNHY | - | - | 7.0e-10 | 63% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 76% |
| Sma3 | Tetratricopeptide-like helical | - | - | 1.987e-12 | - |
| Source | Gene names |
|---|---|
| Sma3 | AP22.43; At1g08070; At1g09410; At1g11290; At1g18485; At1g56690; At1g68930; At2g22070; At3g02010; At3g12770; At3g23330; At3g46790; At3g49140; At3g49710; At3g57430; At4g02750; At4g16835; At4g30700; At4g33170; At4g33990; At4g37170; At4g37380; At5g65570; B103 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | endonuclease activity | GO:0004519 | Molecular Function | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | mRNA modification | GO:0016556 | Biological Process | 0.0 | - |
| Sma3 | chloroplast RNA processing | GO:0031425 | Biological Process | 0.0 | - |
| Sma3 | polycistronic mRNA processing | GO:0031426 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Peptidase S8/S53, subtilisin/kexin/sedolisin | IPR000209 | - | 0.0 | - |
| Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
| Sma3 | Legume lectin domain | IPR001220 | - | 0.0 | - |
| Sma3 | Pentatricopeptide repeat | IPR002885 | - | 0.0 | - |
| Sma3 | Immunoglobulin/major histocompatibility complex, conserved site | IPR003006 | - | 0.0 | - |
| Sma3 | MAP kinase, conserved site | IPR003527 | - | 0.0 | - |
| Sma3 | Uncharacterised protein family Cys-rich | IPR006461 | - | 0.0 | - |
| Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
| Sma3 | Tetratricopeptide-like helical | IPR011990 | - | 0.0 | - |
| Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
| Sma3 | IPR017442 | - | 0.0 | - | |
| Sma3 | Thioredoxin, conserved site | IPR017937 | - | 0.0 | - |
| Sma3 | IPR018115 | - | 0.0 | - | |
| Sma3 | Asp/Glu racemase, active site | IPR018187 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT4G30700.1 | Pentatricopeptide repeat (PPR) superfamily protein chr4:14962617-14964995 REVERSE LENGTH=792 | 2.0e-13 | 73% |
| RefSeq | Arabidopsis thaliana | NP_194799.1 | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] | 3.0e-13 | 73% |
| RefSeq | Populus trichocarpa | XP_002335047.1 | predicted protein, partial [Populus trichocarpa] | 8.0e-13 | 60% |
| Full-Lengther Next Prediction |
|---|
Fln status: C-terminus
Fln database: coniferopsida.fasta
Fln subject: D5AAH8
Fln msg: your sequence is shorter than subject: 47 - 210
Fln protein:
K
Protein Length:
48
Fln nts:
A
Fln Alignment:
F585NNT02I7CIX___KNLRVCVDCHTATKFXXXXXXXXXXXRDGSRFHRFKDSVCSCGEYW
D5AAH8_______________KNLRVCVDCHTATKFISKIAGREIVVRDANRFHHFKDGLCSCGDYW
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
