SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene53910

Length: 111 nt

UniGene Fasta

>sp_v3.0_unigene53910
ACCAGGTTCTGATTCTCCGAAGGTTACCCCTGAGGTTATTGCAGAATACACAGTAAGGGCTCTTCAGAGGACTGTGCCACCTGCAGTGCCCGNATAATGTTTCTATCCGGC

Ace file of the UniGene sp_v3.0_unigene53910

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Fructose-bisphosphate aldolase n=1 Tax=Picea sitchensis RepID=A9NMQ0_PICSI	-	-	1.0e-08	96%
FL-Next	sp=Fructose-bisphosphate aldolase; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	96%
Sma3	Fructose-bisphosphate aldolase	-	-	0.0	-

Source	ECs	Term	Type	e value	Identity
Sma3	Fructose-bisphosphate aldolase.	EC:4.1.2.13	-	0.0	-

Source	KEGGs	Term	Identity
Sma3	Glycolysis / Gluconeogenesis	00010	%
Sma3	Pentose phosphate pathway	00030	%
Sma3	Fructose and mannose metabolism	00051	%
Sma3	Methane metabolism	00680	%
Sma3	Carbon fixation in photosynthetic organisms	00710	%
Sma3	Biosynthesis of phenylpropanoids	01061	%
Sma3	Biosynthesis of terpenoids and steroids	01062	%
Sma3	Biosynthesis of alkaloids derived from shikimate pathway	01063	%
Sma3	Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid	01064	%
Sma3	Biosynthesis of alkaloids derived from histidine and purine	01065	%
Sma3	Biosynthesis of alkaloids derived from terpenoid and polyketide	01066	%
Sma3	Biosynthesis of plant hormones	01070	%
Sma3	Metabolic pathways	01100	%
Sma3	Biosynthesis of secondary metabolites	01110	%

Source	Gene names
Sma3	ALDC; AT3G52930; AT4g26530; At3g52930; At4g26520; At4g26530; F8J2_100; FBA; LOC_Os05g33380; LOC_Os10g08022; M3E9.40; M3E9.50; OSJNBa0035J16.18; OSJNBb0006J12.6; Os05g0402700; Os06g0608700; OsI_16195; OsI_19907; OsI_23662; OsJ_18486; OsJ_30817; P0556B08.18

Source	GOs	Term	Type	Identity
Sma3	cell wall	GO:0005618	Cellular Component	-
Sma3	nucleolus	GO:0005730	Cellular Component	-
Sma3	cytoplasm	GO:0005737	Cellular Component	-
Sma3	mitochondrial envelope	GO:0005740	Cellular Component	-
Sma3	plasma membrane	GO:0005886	Cellular Component	-
Sma3	chloroplast	GO:0009507	Cellular Component	-
Sma3	apoplast	GO:0048046	Cellular Component	-
Sma3	fructose-bisphosphate aldolase activity	GO:0004332	Molecular Function	-
Sma3	protein binding	GO:0005515	Molecular Function	-
Sma3	response to hypoxia	GO:0001666	Biological Process	-
Sma3	glycolysis	GO:0006096	Biological Process	-
Sma3	response to salt stress	GO:0009651	Biological Process	-
Sma3	response to cadmium ion	GO:0046686	Biological Process	-

Source	InterPros	Term	Type	e value	Identity
Sma3	Fructose-bisphosphate aldolase, class-I	IPR000741	-	0.0	-
Sma3	Aldolase-type TIM barrel	IPR013785	-	0.0	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT4G26530.1	Aldolase superfamily protein chr4:13391566-13392937 FORWARD LENGTH=358	7.0e-12	90%
RefSeq	Arabidopsis thaliana	NP_194383.1	fructose-bisphosphate aldolase, class I [Arabidopsis thaliana]	9.0e-12	90%
RefSeq	Populus trichocarpa	XP_002299056.1	predicted protein [Populus trichocarpa]	2.0e-12	93%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: A9NMQ0

Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 91 aas, your sequence is shorter than subject: 32 - 358

Fln protein: PGSDSPKVTPEVIAEYTVRALQRTVPPAVPE*

Protein Length: 33

Fln nts: ACCAGGTTCTGATTCTCCGAAGGTTACCCCTGAGGTTATTGCAGAATACACAGTAAGGGCTCTTCAGAGGACTGTGCCACCTGCAGTGCCCGaATAATGTTTCTATCCGGC

Fln Alignment:

F585NNT02GRUPH___PGSDSPKVTPEVIAEYTVRALQRTVPPAVP
A9NMQ0_______________PGSDAPKVTPEVIAEYTVRALQRTVPPAVP

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain