UniGene Name: sp_v3.0_unigene53910
Length: 111 nt
UniGene Fasta |
---|
>sp_v3.0_unigene53910
A |
Ace file of the UniGene sp_v3.0_unigene53910 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Fructose-bisphosphate aldolase n=1 Tax=Picea sitchensis RepID=A9NMQ0_PICSI | - | - | 1.0e-08 | 96% |
FL-Next | sp=Fructose-bisphosphate aldolase; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 96% |
Sma3 | Fructose-bisphosphate aldolase | - | - | 0.0 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Fructose-bisphosphate aldolase. | EC:4.1.2.13 | - | 0.0 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Glycolysis / Gluconeogenesis | 00010 | 0.0 | % | |
Sma3 | Pentose phosphate pathway | 00030 | 0.0 | % | |
Sma3 | Fructose and mannose metabolism | 00051 | 0.0 | % | |
Sma3 | Methane metabolism | 00680 | 0.0 | % | |
Sma3 | Carbon fixation in photosynthetic organisms | 00710 | 0.0 | % | |
Sma3 | Biosynthesis of phenylpropanoids | 01061 | 0.0 | % | |
Sma3 | Biosynthesis of terpenoids and steroids | 01062 | 0.0 | % | |
Sma3 | Biosynthesis of alkaloids derived from shikimate pathway | 01063 | 0.0 | % | |
Sma3 | Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid | 01064 | 0.0 | % | |
Sma3 | Biosynthesis of alkaloids derived from histidine and purine | 01065 | 0.0 | % | |
Sma3 | Biosynthesis of alkaloids derived from terpenoid and polyketide | 01066 | 0.0 | % | |
Sma3 | Biosynthesis of plant hormones | 01070 | 0.0 | % | |
Sma3 | Metabolic pathways | 01100 | 0.0 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 0.0 | % |
Source | Gene names |
---|---|
Sma3 | ALDC; AT3G52930; AT4g26530; At3g52930; At4g26520; At4g26530; F8J2_100; FBA; LOC_Os05g33380; LOC_Os10g08022; M3E9.40; M3E9.50; OSJNBa0035J16.18; OSJNBb0006J12.6; Os05g0402700; Os06g0608700; OsI_16195; OsI_19907; OsI_23662; OsJ_18486; OsJ_30817; P0556B08.18 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
Sma3 | nucleolus | GO:0005730 | Cellular Component | 0.0 | - |
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | mitochondrial envelope | GO:0005740 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
Sma3 | fructose-bisphosphate aldolase activity | GO:0004332 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | response to hypoxia | GO:0001666 | Biological Process | 0.0 | - |
Sma3 | glycolysis | GO:0006096 | Biological Process | 0.0 | - |
Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Fructose-bisphosphate aldolase, class-I | IPR000741 | - | 0.0 | - |
Sma3 | Aldolase-type TIM barrel | IPR013785 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G26530.1 | Aldolase superfamily protein chr4:13391566-13392937 FORWARD LENGTH=358 | 7.0e-12 | 90% |
RefSeq | Arabidopsis thaliana | NP_194383.1 | fructose-bisphosphate aldolase, class I [Arabidopsis thaliana] | 9.0e-12 | 90% |
RefSeq | Populus trichocarpa | XP_002299056.1 | predicted protein [Populus trichocarpa] | 2.0e-12 | 93% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NMQ0
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 91 aas, your sequence is shorter than subject: 32 - 358
Fln protein:
P
Protein Length:
33
Fln nts:
A
Fln Alignment:
F585NNT02GRUPH___PGSDSPKVTPEVIAEYTVRALQRTVPPAVP
A9NMQ0_______________PGSDAPKVTPEVIAEYTVRALQRTVPPAVP
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain