UniGene Name: sp_v3.0_unigene53888
Length: 127 nt
![]() |
---|
>sp_v3.0_unigene53888
G |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Pectinesterase n=1 Tax=Picea sitchensis RepID=A9NW72_PICSI | - | - | 6.0e-14 | 82% |
FL-Next | sp=Pectinesterase; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 82% |
Sma3 | Pectinesterase | - | - | 0.0 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Pectinesterase. | EC:3.1.1.11 | - | 0.0 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Pentose and glucuronate interconversions | 00040 | 0.0 | % | |
Sma3 | Starch and sucrose metabolism | 00500 | 0.0 | % | |
Sma3 | Metabolic pathways | 01100 | 0.0 | % |
Source | Gene names |
---|---|
Sma3 | ARATH1; ARATH17; ARATH32; ARATH35; ARATH41; ARATH8; At1g02810; At1g53830; At2g45220; At3g43270; At3g59010; At4g02330; B1011A07.22; F17J16.60; F22D16.20; F4L23.27; F7K15.120; GSVIVT00016357001; GSVIVT00017261001; GSVIVT00017264001; GSVIVT00017266001; GSVIV |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | extracellular region | GO:0005576 | Cellular Component | 0.0 | - |
Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
Sma3 | plant-type cell wall | GO:0009505 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | enzyme inhibitor activity | GO:0004857 | Molecular Function | 0.0 | - |
Sma3 | pectinesterase activity | GO:0030599 | Molecular Function | 0.0 | - |
Sma3 | aspartyl esterase activity | GO:0045330 | Molecular Function | 0.0 | - |
Sma3 | fruit ripening | GO:0009835 | Biological Process | 0.0 | - |
Sma3 | cell wall modification | GO:0042545 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Pectinesterase, catalytic | IPR000070 | - | 0.0 | - |
Sma3 | Metallophosphoesterase domain | IPR004843 | - | 0.0 | - |
Sma3 | Pectinesterase inhibitor | IPR006501 | - | 0.0 | - |
Sma3 | Carbohydrate-binding/sugar hydrolysis domain | IPR006633 | - | 0.0 | - |
Sma3 | Pectin lyase fold | IPR012334 | - | 0.0 | - |
Sma3 | Pectinesterase, active site | IPR018040 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G02330.1 | ATPMEPCRB Plant invertase/pectin methylesterase inhibitor superfamily chr4:1032479-1034928 FORWARD LENGTH=573 | 1.0e-16 | 69% |
RefSeq | Arabidopsis thaliana | NP_567227.1 | pectinesterase 41 [Arabidopsis thaliana] | 2.0e-16 | 69% |
RefSeq | Populus trichocarpa | XP_002322401.1 | predicted protein [Populus trichocarpa] | 3.0e-17 | 75% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NW72
Fln msg: Distance to subject end: 62 aas, your sequence is shorter than subject: 42 - 571
Fln protein:
V
Protein Length:
43
Fln nts:
G
Fln Alignment:
F5V9AAZ01EWFST___PTYLGRPWMQYSRTVFMQSYLDKSIAPAGWYEWSGNFALNT
A9NW72_______________PTYLGRPWKPYSRTVYMQSYFDKIIAPAGWYPWSGNFALKT
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain