|
||||||
|
UniGene Name: sp_v3.0_unigene53696
Length: 189 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene53696
C |
|
Ace file of the UniGene sp_v3.0_unigene53696
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | R2R3-MYB transcription factor MYB13 n=2 Tax=Picea RepID=A5JYF7_PICGL | - | - | 2.0e-13 | 72% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 72% |
| Sma3 | Typical P-type R2R3 Myb protein | - | - | 7.208e-10 | - |
| Source | Gene names |
|---|---|
| Sma3 | At1g22640; At1g35515; At4g09460; At4g34990; At4g38620; F12K8.1; F20M13.180; GSVIVT00036110001; GSVIVT00036753001; GSVIVT00038661001; HlMYB1; LOC_Os11g07890; LOC_Os12g07640; M4E13.50; MYB057; MYB093; MYB1; MYB10; MYB150; MYB156; MYB168; MYB179; MYB221; MYB |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | cysteine-type peptidase activity | GO:0008234 | Molecular Function | 0.0 | - |
| Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
| Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
| Sma3 | response to wounding | GO:0009611 | Biological Process | 0.0 | - |
| Sma3 | cold acclimation | GO:0009631 | Biological Process | 0.0 | - |
| Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
| Sma3 | response to ethylene stimulus | GO:0009723 | Biological Process | 0.0 | - |
| Sma3 | response to auxin stimulus | GO:0009733 | Biological Process | 0.0 | - |
| Sma3 | response to abscisic acid stimulus | GO:0009737 | Biological Process | 0.0 | - |
| Sma3 | response to gibberellin stimulus | GO:0009739 | Biological Process | 0.0 | - |
| Sma3 | response to salicylic acid stimulus | GO:0009751 | Biological Process | 0.0 | - |
| Sma3 | response to jasmonic acid stimulus | GO:0009753 | Biological Process | 0.0 | - |
| Sma3 | cinnamic acid biosynthetic process | GO:0009800 | Biological Process | 0.0 | - |
| Sma3 | negative regulation of metabolic process | GO:0009892 | Biological Process | 0.0 | - |
| Sma3 | response to UV-B | GO:0010224 | Biological Process | 0.0 | - |
| Sma3 | GO:0016481 | Biological Process | 0.0 | - | |
| Sma3 | GO:0045449 | Biological Process | 0.0 | - | |
| Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | SANT/Myb domain | IPR001005 | - | 0.0 | - |
| Sma3 | Peptidase C48, SUMO/Sentrin/Ubl1 | IPR003653 | - | 0.0 | - |
| Sma3 | Transposon, En/Spm-like | IPR004242 | - | 0.0 | - |
| Sma3 | IPR012287 | - | 0.0 | - | |
| Sma3 | IPR014778 | - | 0.0 | - | |
| Sma3 | Myb transcription factor | IPR015495 | - | 0.0 | - |
| Sma3 | Myb-like domain | IPR017877 | - | 0.0 | - |
| Sma3 | Myb domain, DNA-binding | IPR017930 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT4G38620.1 | ATMYB4, MYB4 myb domain protein 4 chr4:18053866-18054876 FORWARD LENGTH=282 | 2.0e-17 | 70% |
| RefSeq | Arabidopsis thaliana | NP_195574.1 | transcription repressor MYB4 [Arabidopsis thaliana] | 3.0e-17 | 70% |
| RefSeq | Populus trichocarpa | XP_002312966.1 | predicted protein [Populus trichocarpa] | 8.0e-17 | 68% |
| Full-Lengther Next Prediction |
|---|
Fln status: N-terminus
Fln database: coniferopsida.fasta
Fln subject: A9NY74
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 132 aas, your sequence is shorter than subject: 50 - 192
Fln protein:
M
Protein Length:
51
Fln nts:
C
Fln Alignment:
F585NNT02I6QV2___MGRSPCCDKAHTNKKGAWTKAEDERLIACIEANGEGSWRSLSQGRRFL
A9NY74_______________MGRSPCCEKVHANNKGAWTKEEDERLIAHIEAHGEGSWRSLPKAAGLL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
