UniGene Name: sp_v3.0_unigene53564
Length: 179 nt
![]() |
---|
>sp_v3.0_unigene53564
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | JmjC domain containing protein | - | - | 5.0e-10 | 37% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 87% |
Sma3 | ENBP1 protein | - | - | 4.484e-08 | - |
Source | Gene names |
---|---|
Sma3 | AT1G09060; AT4g00990; At1g09060; At1g11950; At1g62310; At3g07610; At4g00990; B1175F05.34; ENBP1; F12F1.18; F7G19.7; GSVIVT00006884001; GSVIVT00008625001; GSVIVT00011146001; GSVIVT00022742001; GSVIVT00023403001; GSVIVT00031870001; GSVIVT00037256001; LOC_Os |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
Sma3 | pollen development | GO:0009555 | Biological Process | 0.0 | - |
Sma3 | flower development | GO:0009908 | Biological Process | 0.0 | - |
Sma3 | DNA methylation on cytosine | GO:0032776 | Biological Process | 0.0 | - |
Sma3 | histone H3-K9 demethylation | GO:0033169 | Biological Process | 0.0 | - |
Sma3 | leaf development | GO:0048366 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Reverse transcriptase | IPR000477 | - | 0.0 | - |
Sma3 | Peptidase M14, carboxypeptidase A | IPR000834 | - | 0.0 | - |
Sma3 | Zinc finger, RING-type | IPR001841 | - | 0.0 | - |
Sma3 | JmjC domain | IPR003347 | - | 0.0 | - |
Sma3 | IPR013129 | - | 0.0 | - | |
Sma3 | WRC | IPR014977 | - | 0.0 | - |
Sma3 | AT hook, DNA-binding motif | IPR017956 | - | 0.0 | - |
Sma3 | Zinc finger, C3HC4 RING-type | IPR018957 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G00990.1 | Transcription factor jumonji (jmjC) domain-containing protein chr4:427035-431535 FORWARD LENGTH=840 | 2.0e-18 | 77% |
RefSeq | Arabidopsis thaliana | NP_192008.3 | Transcription factor jumonji (jmjC) domain-containing protein [Arabidopsis thaliana] | 3.0e-18 | 77% |
RefSeq | Populus trichocarpa | XP_002321404.1 | predicted protein [Populus trichocarpa] | 2.0e-18 | 87% |
![]() |
---|
Fln status: Putative N-terminus
Fln database: coniferopsida.fasta
Fln subject: D5ABD5
Fln msg: Distance to subject end: 88 aas, W1: There is no M at the beginning, your sequence is shorter than subject: 55 - 133
Fln protein:
S
Protein Length:
56
Fln nts:
A
Fln Alignment:
F51TW9002I2CJT___FSVEPWTFQQHLGEAVLIPAGCPHQVRNLKSCIKVALDF
D5ABD5_______________YQVEPWTFEQHLGEAVFIPAGCPHQVRNLKSCIKVALNF
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain