UniGene Name: sp_v3.0_unigene53303
Length: 234 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
![]() |
---|
>sp_v3.0_unigene53303
G |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Serine/threonine-protein kinase PBS1, putative n=1 Tax=Ricinus communis RepID=B9RNY7_RICCO | - | - | 6.0e-12 | 63% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 57% |
Sma3 | BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1, putative | - | - | 1.551e-07 | - |
Source | Gene names |
---|---|
Sma3 | AT1G60800; AT1G71830; At1g60800; At4g33430; At4g34440; At4g34440/T4L20_20; BAK1; F14O23.21; F17M5.190; F8A5.31; GSVIVT00001777001; GSVIVT00004178001; GSVIVT00004248001; GSVIVT00006101001; GSVIVT00010906001; GSVIVT00023633001; GSVIVT00026073001; GSVIVT0002 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | endosome membrane | GO:0010008 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | protein complex | GO:0043234 | Cellular Component | 0.0 | - |
Sma3 | sequence-specific DNA binding transcription factor activity | GO:0003700 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
Sma3 | structural constituent of cell wall | GO:0005199 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | sequence-specific DNA binding | GO:0043565 | Molecular Function | 0.0 | - |
Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G33430.2 | BAK1 BRI1-associated receptor kinase chr4:16086654-16090288 REVERSE LENGTH=662 | 4.0e-15 | 58% |
RefSeq | Arabidopsis thaliana | NP_567920.1 | BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 [Arabidopsis thaliana] | 5.0e-15 | 58% |
RefSeq | Populus trichocarpa | XP_002308689.1 | predicted protein [Populus trichocarpa] | 2.0e-16 | 58% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LPC1
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 166 aas, your sequence is shorter than subject: 71 - 611
Fln protein:
S
Protein Length:
72
Fln nts:
G
Fln Alignment:
F51TW9001ELRD3___SLADCLFNSKRPTS-LSWPERYKIAVGIARGLTYLHEFAKPAIIHRDVKAANVLLDRPF
B8LPC1_______________SLHDNLFDHRRSERRLDWPTRCQIAVGMARGLAYLHHEIQPGIIHRDIKASNILLDENF
![]() |
---|
Start position | End position | Sequence | Length |
---|---|---|---|
4 | 16 | TCT TCT TCT TCT T | 13 |
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain