UniGene Name: sp_v3.0_unigene53247
Length: 124 nt
UniGene Fasta |
---|
>sp_v3.0_unigene53247
C |
Ace file of the UniGene sp_v3.0_unigene53247 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Aldehyde dehydrogenase, putative n=1 Tax=Ricinus communis RepID=B9SH74_RICCO | - | - | 3.0e-09 | 86% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 91% |
Sma3 | Aldehyde dehydrogenase | - | - | 2.732e-14 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Aldehyde dehydrogenase (NAD(+)). | EC:1.2.1.3 | - | 2.794e-15 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Glycolysis / Gluconeogenesis | 00010 | 2.794e-15 | % | |
Sma3 | Pentose and glucuronate interconversions | 00040 | 2.794e-15 | % | |
Sma3 | Ascorbate and aldarate metabolism | 00053 | 2.794e-15 | % | |
Sma3 | Fatty acid metabolism | 00071 | 2.794e-15 | % | |
Sma3 | Valine, leucine and isoleucine degradation | 00280 | 2.794e-15 | % | |
Sma3 | Lysine degradation | 00310 | 2.794e-15 | % | |
Sma3 | Arginine and proline metabolism | 00330 | 2.794e-15 | % | |
Sma3 | Histidine metabolism | 00340 | 2.794e-15 | % | |
Sma3 | Tryptophan metabolism | 00380 | 2.794e-15 | % | |
Sma3 | beta-Alanine metabolism | 00410 | 2.794e-15 | % | |
Sma3 | Glycerolipid metabolism | 00561 | 2.794e-15 | % | |
Sma3 | Pyruvate metabolism | 00620 | 2.794e-15 | % | |
Sma3 | Chloroalkane and chloroalkene degradation | 00625 | 2.794e-15 | % | |
Sma3 | Propanoate metabolism | 00640 | 2.794e-15 | % | |
Sma3 | Limonene and pinene degradation | 00903 | 2.794e-15 | % | |
Sma3 | Metabolic pathways | 01100 | 2.794e-15 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 2.794e-15 | % | |
Sma3 | Retinal dehydrogenase. | EC:1.2.1.36 | - | 2.307e-07 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Retinol metabolism | 00830 | 2.307e-07 | % | |
Sma3 | Metabolic pathways | 01100 | 2.307e-07 | % |
Source | Gene names |
---|---|
Sma3 | ALDH; ALDH1a; ALDH2; ALDH2B; ALDH2B4; ALDH2B7; ALDH2a; ALDH2b; ALDH3; Aldh; Aldh 2A; Aldh1; Aldh2a; Aldh2b; At1g23800; At3g48000; F5O8.33; F5O8.35; GSVIVT00016121001; GSVIVT00020768001; GSVIVT00028841001; GSVIVT00028844001; GSVIVT00030691001; OSJNBa0072H0 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | mitochondrial matrix | GO:0005759 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | aldehyde dehydrogenase (NAD) activity | GO:0004029 | Molecular Function | 0.0 | - |
Sma3 | aldehyde dehydrogenase [NAD(P)+] activity | GO:0004030 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Aldehyde dehydrogenase domain | IPR015590 | - | 0.0 | - |
Sma3 | Aldehyde dehydrogenase, conserved site | IPR016160 | - | 0.0 | - |
Sma3 | Aldehyde dehydrogenase, N-terminal | IPR016162 | - | 0.0 | - |
Sma3 | Aldehyde dehydrogenase, C-terminal | IPR016163 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G23800.1 | ALDH2B7, ALDH2B aldehyde dehydrogenase 2B7 chr1:8412238-8414804 REVERSE LENGTH=534 | 2.0e-12 | 88% |
RefSeq | Arabidopsis thaliana | NP_564204.1 | aldehyde dehydrogenase 2B7 [Arabidopsis thaliana] | 3.0e-12 | 88% |
RefSeq | Populus trichocarpa | XP_002321583.1 | predicted protein [Populus trichocarpa] | 9.0e-12 | 85% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NUF6
Fln msg: Distance to subject end: 207 aas, your sequence is shorter than subject: 41 - 544
Fln protein:
R
Protein Length:
42
Fln nts:
C
Fln Alignment:
F5X2MQL01EAHQD___NLKPVTLELGVKPPFIVCEDADVHQAVELAHFAL
A9NUF6_______________NLKPVTLELGGKSPFIVCEDADVDQAVELAHFAL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain