UniGene Name: sp_v3.0_unigene53245
Length: 225 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
![]() |
---|
>sp_v3.0_unigene53245
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Multidrug resistance protein ABC transporter family n=1 Tax=Populus trichocarpa RepID=B9GRC2_POPTR | - | - | 9.0e-29 | 90% |
FL-Next | tr=MDR-like ABC transporter; Taxus cuspidata (Japanese yew). | - | - | 0.0 | 40% |
Sma3 | Multidrug resistance protein ABC transporter family | - | - | 0.0 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | 2-alkenal reductase. | EC:1.3.1.74 | - | 1.179e-10 | - |
Sma3 | Xenobiotic-transporting ATPase. | EC:3.6.3.44 | - | 3.931e-35 | - |
Source | Gene names |
---|---|
Sma3 | At1g04120; At1g30420; At1g71330; At2g34660; At2g47800; At3g13080; At3g13090; At3g13100; At3g21250; At3g59140; At3g60160; At3g60970; At3g62700; B1065G12.13; B1157F09.14; CHLREDRAFT_115938; CHLREDRAFT_119533; CHLREDRAFT_141872; CHLREDRAFT_143900; CHLREDRAFT |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | plant-type vacuole | GO:0000325 | Cellular Component | 0.0 | - |
Sma3 | vacuolar membrane | GO:0005774 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | calmodulin binding | GO:0005516 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | sulfonylurea receptor activity | GO:0008281 | Molecular Function | 0.0 | - |
Sma3 | folic acid transporter activity | GO:0008517 | Molecular Function | 0.0 | - |
Sma3 | xenobiotic-transporting ATPase activity | GO:0008559 | Molecular Function | 0.0 | - |
Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
Sma3 | chlorophyll catabolite transmembrane transporter activity | GO:0010290 | Molecular Function | 0.0 | - |
Sma3 | protein disulfide oxidoreductase activity | GO:0015035 | Molecular Function | 0.0 | - |
Sma3 | glutathione S-conjugate-exporting ATPase activity | GO:0015431 | Molecular Function | 0.0 | - |
Sma3 | ATPase activity | GO:0016887 | Molecular Function | 0.0 | - |
Sma3 | ATPase activity, coupled to transmembrane movement of substances | GO:0042626 | Molecular Function | 0.0 | - |
Sma3 | transport | GO:0006810 | Biological Process | 0.0 | - |
Sma3 | response to water deprivation | GO:0009414 | Biological Process | 0.0 | - |
Sma3 | response to wounding | GO:0009611 | Biological Process | 0.0 | - |
Sma3 | response to nematode | GO:0009624 | Biological Process | 0.0 | - |
Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
Sma3 | stomatal movement | GO:0010118 | Biological Process | 0.0 | - |
Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
Sma3 | cellular potassium ion homeostasis | GO:0030007 | Biological Process | 0.0 | - |
Sma3 | cell redox homeostasis | GO:0045454 | Biological Process | 0.0 | - |
Sma3 | response to other organism | GO:0051707 | Biological Process | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G04120.1 | ATMRP5, MRP5, ATABCC5, ABCC5 multidrug resistance-associated protein 5 chr1:1064848-1070396 REVERSE LENGTH=1514 | 2.0e-34 | 86% |
RefSeq | Arabidopsis thaliana | NP_001184906.1 | ABC transporter C family member 5 [Arabidopsis thaliana] | 2.0e-34 | 86% |
RefSeq | Populus trichocarpa | XP_002301842.1 | multidrug resistance protein ABC transporter family [Populus trichocarpa] | 1.0e-35 | 90% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: E6Y0T0
Fln msg: Distance to subject end: 38 aas, your sequence is shorter than subject: 74 - 1316
Fln protein:
T
Protein Length:
75
Fln nts:
A
Fln Alignment:
F5X2MQL01D65OB___TIIGERGINLSGGQKQRVQLARALYQDADIYLLDDPFSAVDAHTGSELFKEYILGALAMKTVVFI
E6Y0T0_______________TMVGEHGTQLSGGQKQRIAIARAILKDPRILLLDEATSALDTES-ERVVQEALDRIMVNRTTVIV
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain