SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene53153

Length: 155 nt

This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense

UniGene Fasta (sense)

>sp_v3.0_unigene53153
ACCCTGGCTTGATGGCAGTCTTCCAGGAGACTTCGGGTTCGATCCACTCGGACTAGACCCTGAGACCCTCAAATGGATGGTACAGTCTGAGCTAGTTCATTGCAGATGGGCAATGCTGGGGGCAAGCTAGGAATCTTCATTCCAGAGCTGTTGAC

Ace file of the UniGene sp_v3.0_unigene53153 (antisense)

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	LHC I type II chlorophyll binding protein (Fragment) n=1 Tax=Pinus sylvestris RepID=Q8RU80_PINSY	-	-	4.0e-17	90%
FL-Next	tr=Type II chlorophyll a /b-binding protein; Pinus sylvestris (Scots pine).	-	-	0.0	90%
Sma3	Chlorophyll A/B binding protein, putative	-	-	6.129e-17	-

Source	Gene names
Sma3	AT1G45474; AT3g54890/F28P10_130; At1g15820; At1g15820/F7H2.16; At1g19150; At1g45474; At3g47470; At3g54890; At3g61470; CAB4; CAB7; CAP10A; CAP10B; CHLREDRAFT_183363; CHLREDRAFT_192961; Cab; Cab27; Cab4; Cab6; CipCp24; F1P2.20; F28P10.130; F2A19.70; F2G19.4

Source	GOs	Term	Type	Identity
Sma3	chloroplast	GO:0009507	Cellular Component	-
Sma3	photosystem I	GO:0009522	Cellular Component	-
Sma3	photosystem II	GO:0009523	Cellular Component	-
Sma3	chloroplast thylakoid membrane	GO:0009535	Cellular Component	-
Sma3	thylakoid	GO:0009579	Cellular Component	-
Sma3	photosystem I antenna complex	GO:0009782	Cellular Component	-
Sma3	photosystem II antenna complex	GO:0009783	Cellular Component	-
Sma3	chloroplast envelope	GO:0009941	Cellular Component	-
Sma3	plastoglobule	GO:0010287	Cellular Component	-
Sma3	membrane	GO:0016020	Cellular Component	-
Sma3	integral to membrane	GO:0016021	Cellular Component	-
Sma3	magnesium ion binding	GO:0000287	Molecular Function	-
Sma3	chlorophyll binding	GO:0016168	Molecular Function	-
Sma3	pigment binding	GO:0031409	Molecular Function	-
Sma3	photosynthesis, light harvesting	GO:0009765	Biological Process	-
Sma3	photosynthesis, light harvesting in photosystem I	GO:0009768	Biological Process	-
Sma3	nonphotochemical quenching	GO:0010196	Biological Process	-
Sma3	protein-chromophore linkage	GO:0018298	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Chlorophyll A-B binding protein, plant	IPR001344	-	-
Sma3	CoA-binding	IPR003781	-	-
Sma3	Succinyl-CoA ligase, alpha subunit	IPR005810	-	-
Sma3	ATP-citrate lyase/succinyl-CoA ligase	IPR005811	-	-
Sma3	NAD(P)-binding domain	IPR016040	-	-
Sma3	Succinyl-CoA synthetase-like	IPR016102	-	-
Sma3	ATP-citrate lyase/succinyl-CoA ligase, active site	IPR017440	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT3G61470.1	LHCA2 photosystem I light harvesting complex gene 2 chr3:22745736-22747032 FORWARD LENGTH=257	3.0e-20	81%
RefSeq	Arabidopsis thaliana	NP_191706.2	photosystem I light harvesting complex protein [Arabidopsis thaliana]	4.0e-20	81%
RefSeq	Populus trichocarpa	XP_002303791.1	light-harvesting complex I protein Lhca2 [Populus trichocarpa]	6.0e-22	86%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: Q02070

Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 142 aas, your sequence is shorter than subject: 43 - 278

Fln protein: PWLDGSLPGDFGFDPLGLDPETLKWMVQSELVHCRWAMLGAS*

Protein Length: 44

Fln nts: ACCCTGGCTTGATGGCAGTCTTCCAGGAGACTTCGGGTTCGATCCACTCGGACTAGACCCTGAGACCCTCAAATGGATGGTACAGTCTGAGCTAGTTCATTGCAGATGGGCAATGCTGGGGGCAAGCTAGGAATCTTCATTCCAGAGCTGTTGAC

Fln Alignment:

F5X2MQL01DGKKI___PWLDGSLPGDFGFDPLGL--DPETLKWMVQSELVHCRWAMLGAS
Q02070_______________PWLDGSLPGDFGFDPLGLGSDPETLKWMVQAELVHCRWAMLGAA

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain