UniGene Name: sp_v3.0_unigene53153
Length: 155 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense) |
---|
>sp_v3.0_unigene53153
A |
Ace file of the UniGene sp_v3.0_unigene53153 (antisense) |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | LHC I type II chlorophyll binding protein (Fragment) n=1 Tax=Pinus sylvestris RepID=Q8RU80_PINSY | - | - | 4.0e-17 | 90% |
FL-Next | tr=Type II chlorophyll a /b-binding protein; Pinus sylvestris (Scots pine). | - | - | 0.0 | 90% |
Sma3 | Chlorophyll A/B binding protein, putative | - | - | 6.129e-17 | - |
Source | Gene names |
---|---|
Sma3 | AT1G45474; AT3g54890/F28P10_130; At1g15820; At1g15820/F7H2.16; At1g19150; At1g45474; At3g47470; At3g54890; At3g61470; CAB4; CAB7; CAP10A; CAP10B; CHLREDRAFT_183363; CHLREDRAFT_192961; Cab; Cab27; Cab4; Cab6; CipCp24; F1P2.20; F28P10.130; F2A19.70; F2G19.4 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | photosystem I | GO:0009522 | Cellular Component | 0.0 | - |
Sma3 | photosystem II | GO:0009523 | Cellular Component | 0.0 | - |
Sma3 | chloroplast thylakoid membrane | GO:0009535 | Cellular Component | 0.0 | - |
Sma3 | thylakoid | GO:0009579 | Cellular Component | 0.0 | - |
Sma3 | photosystem I antenna complex | GO:0009782 | Cellular Component | 0.0 | - |
Sma3 | photosystem II antenna complex | GO:0009783 | Cellular Component | 0.0 | - |
Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
Sma3 | plastoglobule | GO:0010287 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | magnesium ion binding | GO:0000287 | Molecular Function | 0.0 | - |
Sma3 | chlorophyll binding | GO:0016168 | Molecular Function | 0.0 | - |
Sma3 | pigment binding | GO:0031409 | Molecular Function | 0.0 | - |
Sma3 | photosynthesis, light harvesting | GO:0009765 | Biological Process | 0.0 | - |
Sma3 | photosynthesis, light harvesting in photosystem I | GO:0009768 | Biological Process | 0.0 | - |
Sma3 | nonphotochemical quenching | GO:0010196 | Biological Process | 0.0 | - |
Sma3 | protein-chromophore linkage | GO:0018298 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Chlorophyll A-B binding protein, plant | IPR001344 | - | 0.0 | - |
Sma3 | CoA-binding | IPR003781 | - | 0.0 | - |
Sma3 | Succinyl-CoA ligase, alpha subunit | IPR005810 | - | 0.0 | - |
Sma3 | ATP-citrate lyase/succinyl-CoA ligase | IPR005811 | - | 0.0 | - |
Sma3 | NAD(P)-binding domain | IPR016040 | - | 0.0 | - |
Sma3 | Succinyl-CoA synthetase-like | IPR016102 | - | 0.0 | - |
Sma3 | ATP-citrate lyase/succinyl-CoA ligase, active site | IPR017440 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G61470.1 | LHCA2 photosystem I light harvesting complex gene 2 chr3:22745736-22747032 FORWARD LENGTH=257 | 3.0e-20 | 81% |
RefSeq | Arabidopsis thaliana | NP_191706.2 | photosystem I light harvesting complex protein [Arabidopsis thaliana] | 4.0e-20 | 81% |
RefSeq | Populus trichocarpa | XP_002303791.1 | light-harvesting complex I protein Lhca2 [Populus trichocarpa] | 6.0e-22 | 86% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: Q02070
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 142 aas, your sequence is shorter than subject: 43 - 278
Fln protein:
P
Protein Length:
44
Fln nts:
A
Fln Alignment:
F5X2MQL01DGKKI___PWLDGSLPGDFGFDPLGL--DPETLKWMVQSELVHCRWAMLGAS
Q02070_______________PWLDGSLPGDFGFDPLGLGSDPETLKWMVQAELVHCRWAMLGAA
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain