UniGene Name: sp_v3.0_unigene53141
Length: 191 nt
UniGene Fasta |
---|
>sp_v3.0_unigene53141
A |
Ace file of the UniGene sp_v3.0_unigene53141 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Putative polyprotein n=1 Tax=Zea mays RepID=Q8SA93_MAIZE | - | - | 4.0e-16 | 65% |
FL-Next | tr=Putative uncharacterized protein; Vitis vinifera (Grape). | - | - | 0.0 | 63% |
Sma3 | Retrotransposon protein, putative, Ty3-gypsy subclass | - | - | 1.102e-37 | - |
Source | Gene names |
---|---|
Sma3 | At2g05610; B1234D02.7; F23H6.1; H0201G08.12; H0207B04.5; H0211F06-OSIGBa0153M17.10; H0409D10.7; H0502B11.9; H0616A11.3; H0807C06-H0308C08.6; LOC_Os03g05350; LOC_Os03g06110; LOC_Os03g10000; LOC_Os03g15450; LOC_Os03g21350; LOC_Os03g23110; LOC_Os03g29790; LO |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | chromatin | GO:0000785 | Cellular Component | 0.0 | - |
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | chromatin binding | GO:0003682 | Molecular Function | 0.0 | - |
Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
Sma3 | carbonate dehydratase activity | GO:0004089 | Molecular Function | 0.0 | - |
Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
Sma3 | endonuclease activity | GO:0004519 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | sugar binding | GO:0005529 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | ATPase activity | GO:0016887 | Molecular Function | 0.0 | - |
Sma3 | protein dimerization activity | GO:0046983 | Molecular Function | 0.0 | - |
Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
Sma3 | chromatin assembly or disassembly | GO:0006333 | Biological Process | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
Sma3 | carbon utilization | GO:0015976 | Biological Process | 0.0 | - |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: tr_plants
Fln subject: A5AQ58
Fln msg: Distance to subject end: 680 aas, your sequence is shorter than subject: 63 - 1308
Fln protein:
M
Protein Length:
64
Fln nts:
A
Fln Alignment:
F5X2MQL01A3DM5___PYLRKFVLVFFDDILIYSKTWKEHLQHLERVLTILEEHQFYAKISKCTFRKEEVEYLRHII
A5AQ58_______________PYLRKFILVFFDBILIYSPTWEQHLEHVQXTLAVLRQHQFYVKXSKXAFGKQELEYLGHII
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain