UniGene Name: sp_v3.0_unigene53002
Length: 196 nt
UniGene Fasta |
---|
>sp_v3.0_unigene53002
A |
Ace file of the UniGene sp_v3.0_unigene53002 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Caffeate O-methyltransferase (Fragment) n=5 Tax=Pinus taeda RepID=Q5IDC8_PINTA | - | - | 2.0e-25 | 93% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 93% |
Sma3 | Caffeic acid 3-O-methyltransferase | - | - | 3.36312e-44 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Caffeate O-methyltransferase. | EC:2.1.1.68 | - | 0.0 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Phenylpropanoid biosynthesis | 00940 | 0.0 | % | |
Sma3 | Biosynthesis of phenylpropanoids | 01061 | 0.0 | % | |
Sma3 | Metabolic pathways | 01100 | 0.0 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 0.0 | % |
Source | Gene names |
---|---|
Sma3 | At5g54160; COMT; COMT1; COMT2; COMT2-2A; CtCAldOMT1; GSVIVT00000478001; GSVIVT00000479001; GSVIVT00037163001; HOMT1; HOMT3; K18G13.3; OMT; OMT I-a; OMT I-b; OMT1; OMT2; Omt II; POPTRDRAFT_824484; POPTRDRAFT_834247; RCOM_0596300; RCOM_1340190; RcOMT2; ccoA |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | O-methyltransferase activity | GO:0008171 | Molecular Function | 0.0 | - |
Sma3 | catechol O-methyltransferase activity | GO:0016206 | Molecular Function | 0.0 | - |
Sma3 | quercetin 3-O-methyltransferase activity | GO:0030755 | Molecular Function | 0.0 | - |
Sma3 | myricetin 3'-O-methyltransferase activity | GO:0033799 | Molecular Function | 0.0 | - |
Sma3 | protein dimerization activity | GO:0046983 | Molecular Function | 0.0 | - |
Sma3 | caffeate O-methyltransferase activity | GO:0047763 | Molecular Function | 0.0 | - |
Sma3 | lignin biosynthetic process | GO:0009809 | Biological Process | 0.0 | - |
Sma3 | flavonol biosynthetic process | GO:0051555 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Ornithine/DAP/Arg decarboxylase | IPR000183 | - | 0.0 | - |
Sma3 | O-methyltransferase, family 2 | IPR001077 | - | 0.0 | - |
Sma3 | Winged helix-turn-helix transcription repressor DNA-binding | IPR011991 | - | 0.0 | - |
Sma3 | Plant methyltransferase dimerisation | IPR012967 | - | 0.0 | - |
Sma3 | O-methyltransferase, COMT, eukaryota | IPR016461 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G54160.1 | ATOMT1, OMT1 O-methyltransferase 1 chr5:21982075-21984167 FORWARD LENGTH=363 | 3.0e-18 | 60% |
RefSeq | Arabidopsis thaliana | NP_200227.1 | Quercetin 3-O-methyltransferase 1 [Arabidopsis thaliana] | 4.0e-18 | 60% |
RefSeq | Populus trichocarpa | XP_002317838.1 | caffeic acid 3-O-methyltransferase [Populus trichocarpa] | 2.0e-21 | 61% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LRV0
Fln msg: Distance to subject end: 228 aas, your sequence is shorter than subject: 64 - 365
Fln protein:
A
Protein Length:
65
Fln nts:
A
Fln Alignment:
F5X2MQL01D37SJ___AAIALDRILRVLASHSVLSCSVTTNKNGKAERFYGLTPLCKYLVNNQDGVSLAPLVLMNQDKV
B8LRV0_______________AAITLDRILRVLASHSVLSCSVTTDENGKAERLYGLTPLCKYLVNNQDGVSLAPLVLMNQDKV
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain