UniGene Name: sp_v3.0_unigene52961
Length: 244 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene52961
A |
Ace file of the UniGene sp_v3.0_unigene52961
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Amine oxidase, putative n=1 Tax=Ricinus communis RepID=B9SUC7_RICCO | - | - | 2.0e-18 | 68% |
| FL-Next | sp=Lysine-specific histone demethylase 1 homolog 3; Oryza sativa subsp. japonica (Rice). | - | - | 0.0 | 61% |
| Sma3 | Protein LSD1-LIKE 2 | - | - | 1.284e-08 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | EC:1.-.-.- | - | 4.875e-14 | - | |
| Sma3 | L-amino-acid oxidase. | EC:1.4.3.2 | - | 7.702e-08 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Alanine, aspartate and glutamate metabolism | 00250 | 7.702e-08 | % | |
| Sma3 | Cysteine and methionine metabolism | 00270 | 7.702e-08 | % | |
| Sma3 | Valine, leucine and isoleucine degradation | 00280 | 7.702e-08 | % | |
| Sma3 | Tyrosine metabolism | 00350 | 7.702e-08 | % | |
| Sma3 | Phenylalanine metabolism | 00360 | 7.702e-08 | % | |
| Sma3 | Tryptophan metabolism | 00380 | 7.702e-08 | % | |
| Sma3 | Phenylalanine, tyrosine and tryptophan biosynthesis | 00400 | 7.702e-08 | % | |
| Sma3 | Isoquinoline alkaloid biosynthesis | 00950 | 7.702e-08 | % | |
| Sma3 | Metabolic pathways | 01100 | 7.702e-08 | % |
| Source | Gene names |
|---|---|
| Sma3 | At1g62830; At3g10390; At3g13682; B0103C08-B0602B01.13; F13M14.34; F14P13.1; F23N19.19; FLD; GSVIVT00018140001; GSVIVT00027608001; GSVIVT00031221001; HDMA1501; HDMA1502; HDMA901; HDMA902; HDMA903; LDL1; LDL2; LOC_Os02g51880; LOC_Os04g47270; LOC_Os08g04780; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
| Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
| Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
| Sma3 | chromatin modification | GO:0016568 | Biological Process | 0.0 | - |
| Sma3 | histone deacetylation | GO:0016575 | Biological Process | 0.0 | - |
| Sma3 | root development | GO:0048364 | Biological Process | 0.0 | - |
| Sma3 | histone H3-K4 methylation | GO:0051568 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Zinc finger, GATA-type | IPR000679 | - | 0.0 | - |
| Sma3 | Amine oxidase | IPR002937 | - | 0.0 | - |
| Sma3 | Aromatic-ring hydroxylase-like | IPR003042 | - | 0.0 | - |
| Sma3 | SWIRM domain | IPR007526 | - | 0.0 | - |
| Sma3 | Peptidase C14, ICE, catalytic subunit p20, active site | IPR016129 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G62830.1 | LDL1, SWP1, ATSWP1, ATLSD1, LSD1 LSD1-like 1 chr1:23264638-23267172 REVERSE LENGTH=844 | 5.0e-22 | 73% |
| RefSeq | Arabidopsis thaliana | NP_176471.1 | Lysine-specific histone demethylase 1-1 [Arabidopsis thaliana] | 7.0e-22 | 73% |
| RefSeq | Populus trichocarpa | XP_002300664.1 | predicted protein [Populus trichocarpa] | 3.0e-23 | 71% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q7XUR2
Fln msg: Distance to subject end: 147 aas, your sequence is shorter than subject: 80 - 811
Fln protein:
G
Protein Length:
81
Fln nts:
A
Fln Alignment:
F5X2MQL01E3FEI___GASGSDYDTLAESVGNGRIFFAGEATSRQYPATMHGAFLSGLREAAKIANIANSKSMTMSSIERGLSKAVNAVQLFLI
Q7XUR2_______________GASGDDYDILAESVGDGRLFFAGEATTRRYPATMHGAFISGLREAANITLHANARA-AKSKVEKGPSTNTQACAALLM

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta