|
||||||
|
UniGene Name: sp_v3.0_unigene52736
Length: 176 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene52736
A |
|
Ace file of the UniGene sp_v3.0_unigene52736
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Auxin efflux facilitator SlPIN2 n=1 Tax=Solanum lycopersicum RepID=E5KGD3_SOLLC | - | - | 4.0e-16 | 74% |
| FL-Next | tr=PIN-like auxin efflux carrier; Picea abies (Norway spruce) (Picea excelsa). | - | - | 0.0 | 70% |
| Sma3 | Auxin efflux carrier component | - | - | 2.23e-29 | - |
| Source | Gene names |
|---|---|
| Sma3 | AEC1; AEC2; AEC3; AEH1; AGR; AGR1; AT1G23080; At1g23080; At1g70940; At1g73590; At2g01420; At5g57090; CS-PIN1; EIR1; F15H11.14; F2I9.4; F6D5.2; GSVIVT00017824001; GSVIVT00023254001; GSVIVT00030482001; GSVIVT00031315001; GSVIVT00033553001; LOC_Os01g45550; L |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | lytic vacuole | GO:0000323 | Cellular Component | 0.0 | - |
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | auxin efflux carrier complex | GO:0009921 | Cellular Component | 0.0 | - |
| Sma3 | basal plasma membrane | GO:0009925 | Cellular Component | 0.0 | - |
| Sma3 | cell surface | GO:0009986 | Cellular Component | 0.0 | - |
| Sma3 | vesicle membrane | GO:0012506 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | lateral plasma membrane | GO:0016328 | Cellular Component | 0.0 | - |
| Sma3 | apical part of cell | GO:0045177 | Cellular Component | 0.0 | - |
| Sma3 | transporter activity | GO:0005215 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | auxin efflux transmembrane transporter activity | GO:0010329 | Molecular Function | 0.0 | - |
| Sma3 | transport | GO:0006810 | Biological Process | 0.0 | - |
| Sma3 | pattern specification process | GO:0007389 | Biological Process | 0.0 | - |
| Sma3 | gravitropism | GO:0009630 | Biological Process | 0.0 | - |
| Sma3 | photomorphogenesis | GO:0009640 | Biological Process | 0.0 | - |
| Sma3 | response to ethylene stimulus | GO:0009723 | Biological Process | 0.0 | - |
| Sma3 | auxin mediated signaling pathway | GO:0009734 | Biological Process | 0.0 | - |
| Sma3 | auxin polar transport | GO:0009926 | Biological Process | 0.0 | - |
| Sma3 | longitudinal axis specification | GO:0009942 | Biological Process | 0.0 | - |
| Sma3 | positive gravitropism | GO:0009958 | Biological Process | 0.0 | - |
| Sma3 | xylem and phloem pattern formation | GO:0010051 | Biological Process | 0.0 | - |
| Sma3 | regulation of root meristem growth | GO:0010082 | Biological Process | 0.0 | - |
| Sma3 | leaf formation | GO:0010338 | Biological Process | 0.0 | - |
| Sma3 | leaf shaping | GO:0010358 | Biological Process | 0.0 | - |
| Sma3 | root development | GO:0048364 | Biological Process | 0.0 | - |
| Sma3 | root hair initiation | GO:0048766 | Biological Process | 0.0 | - |
| Sma3 | root hair elongation | GO:0048767 | Biological Process | 0.0 | - |
| Sma3 | adventitious root development | GO:0048830 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Auxin efflux carrier | IPR004776 | - | 0.0 | - |
| Sma3 | Mpp10 protein | IPR007151 | - | 0.0 | - |
| Sma3 | Auxin efflux carrier, plant type | IPR014024 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT2G01420.2 | PIN4 Auxin efflux carrier family protein chr2:180478-183199 REVERSE LENGTH=616 | 9.0e-21 | 70% |
| RefSeq | Arabidopsis thaliana | NP_565261.1 | auxin efflux carrier component 4 [Arabidopsis thaliana] | 1.0e-20 | 70% |
| RefSeq | Populus trichocarpa | XP_002324677.1 | auxin efflux carrier component [Populus trichocarpa] | 2.0e-20 | 68% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B5TXD0
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 97 aas, your sequence is shorter than subject: 55 - 699
Fln protein:
M
Protein Length:
56
Fln nts:
A
Fln Alignment:
F5V9AAZ02J0TPL___VWRKLARNPNTYASVIGITWALISYRWNFAMPRILEGSVTILSDAGLGMAI
B5TXD0_______________VWRKLIRNPNTYSSLIGLIWALVSFRWNVHMPRIVAHSIAILSDAGLGMAM
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
