UniGene Name: sp_v3.0_unigene52679
Length: 200 nt
![]() |
---|
>sp_v3.0_unigene52679
G |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Retinoblastoma-related protein 1 n=1 Tax=Nicotiana tabacum RepID=RBR1_TOBAC | - | - | 4.0e-13 | 70% |
FL-Next | sp=Retinoblastoma-related protein 1; Nicotiana tabacum (Common tobacco). | - | - | 0.0 | 70% |
Sma3 | Retinoblastoma-related protein 1 | - | - | 1.091e-19 | - |
Source | Gene names |
---|---|
Sma3 | At3g12280; F28J15.11; GSVIVT00032361001; LOC_Os11g32900; NtRb1; Os11g0533500; OsI_029040; OsI_36358; OsJ_34123; PHYPADRAFT_10629; PHYPADRAFT_84532; POPTRDRAFT_547794; RB; RB1; RBL1501; RBL1502; RBL901; RBR; RBR1; RBR2; RCOM_1264670; RRB1; Rb1; Rbr; Rbr1; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | transcription factor binding | GO:0008134 | Molecular Function | 0.0 | - |
Sma3 | G1/S transition of mitotic cell cycle | GO:0000082 | Biological Process | 0.0 | - |
Sma3 | regulation of gene expression by genetic imprinting | GO:0006349 | Biological Process | 0.0 | - |
Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
Sma3 | cell cycle | GO:0007049 | Biological Process | 0.0 | - |
Sma3 | embryo sac development | GO:0009553 | Biological Process | 0.0 | - |
Sma3 | double fertilization forming a zygote and endosperm | GO:0009567 | Biological Process | 0.0 | - |
Sma3 | trichome morphogenesis | GO:0010090 | Biological Process | 0.0 | - |
Sma3 | generative cell differentiation | GO:0022619 | Biological Process | 0.0 | - |
Sma3 | regulation of DNA endoreduplication | GO:0032875 | Biological Process | 0.0 | - |
Sma3 | interspecies interaction between organisms | GO:0044419 | Biological Process | 0.0 | - |
Sma3 | regulation of cell cycle | GO:0051726 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | D-alanine--D-alanine ligase/VANA/B/C, conserved site | IPR000291 | - | 0.0 | - |
Sma3 | Retinoblastoma-associated protein, B-box | IPR002719 | - | 0.0 | - |
Sma3 | Retinoblastoma-associated protein, A-box | IPR002720 | - | 0.0 | - |
Sma3 | IPR006670 | - | 0.0 | - | |
Sma3 | Cyclin-like | IPR013763 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G12280.1 | RBR1, RBR, RB, ATRBR1, RB1 retinoblastoma-related 1 chr3:3913671-3918433 REVERSE LENGTH=1013 | 7.0e-16 | 66% |
RefSeq | Arabidopsis thaliana | NP_001189868.1 | Retinoblastoma-related protein 1 [Arabidopsis thaliana] | 9.0e-16 | 66% |
RefSeq | Populus trichocarpa | XP_002297730.1 | hypothetical protein POPTRDRAFT_547794 [Populus trichocarpa] | 4.0e-15 | 61% |
![]() |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q9SXN6
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 505 aas, your sequence is shorter than subject: 66 - 961
Fln protein:
E
Protein Length:
67
Fln nts:
G
Fln Alignment:
F51TW9002HWL1A___ATPYTSEHKNKMTTAKWLRTVIAPLPPKPSSELGYFLSSCDRDITADVSHRARIILE
Q9SXN6_______________ATPVSTA----MTTARWLRTVIAPLQPKPSAELERFLSSCDRDVTADVIRRAQIILE
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain