UniGene Name: sp_v3.0_unigene52657
Length: 182 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene52657
C |
Ace file of the UniGene sp_v3.0_unigene52657
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | translation elongation factor-1 alpha [Pseudotsuga menziesii var. menziesii] gb|AAV92326.1| translation elongation factor-1 alpha [Pseudotsuga menziesii var. menziesii] gb|AAV92327.1| translation elongation factor-1 alpha [Pseudotsuga menziesii var. menzi | - | - | 3.0e-23 | 91% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 91% |
| Sma3 | Elongation factor 1-alpha | - | - | 0.0 | - |
| Source | Gene names |
|---|---|
| Sma3 | A1; A2; A3; A4; AT1G07930; AT1G07940; AT5G60390; AcoEF1a; At1g07920; At1g07920/T6D22.2; At1g07930; At1g07940; At1g35550; At5g60390; BLT63; EF-1; EF-1-alpha; EF-1-alpha1; EF-1alpha; EF1; EF1-A; EF1-a; EF1-a1; EF1A; EF1A1; EF1A2; EF1A3; EF1A4; EF1A5; EF1A6; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleolus | GO:0005730 | Cellular Component | 0.0 | - |
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
| Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | translation elongation factor activity | GO:0003746 | Molecular Function | 0.0 | - |
| Sma3 | GTPase activity | GO:0003924 | Molecular Function | 0.0 | - |
| Sma3 | GTP binding | GO:0005525 | Molecular Function | 0.0 | - |
| Sma3 | translational elongation | GO:0006414 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Protein synthesis factor, GTP-binding | IPR000795 | - | 0.0 | - |
| Sma3 | Translation elongation factor EFTu/EF1A, C-terminal | IPR004160 | - | 0.0 | - |
| Sma3 | Translation elongation factor EFTu/EF1A, domain 2 | IPR004161 | - | 0.0 | - |
| Sma3 | Translation elongation factor EF1A, eukaryotic/archaeal | IPR004539 | - | 0.0 | - |
| Sma3 | Carbohydrate kinase, FGGY, conserved site | IPR018483 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G60390.1 | GTP binding Elongation factor Tu family protein chr5:24289226-24290675 FORWARD LENGTH=449 | 2.0e-27 | 83% |
| RefSeq | Arabidopsis thaliana | NP_001077483.1 | Elongation factor 1-alpha [Arabidopsis thaliana] | 2.0e-27 | 83% |
| RefSeq | Populus trichocarpa | XP_002315286.1 | predicted protein, partial [Populus trichocarpa] | 1.0e-30 | 88% |
Full-Lengther Next Prediction |
|---|
Fln status: Putative C-terminus
Fln database: coniferopsida.fasta
Fln subject: A9P004
Fln msg: STOP codon was not found. Distance to subject end: 9 aas, your sequence is shorter than subject: 60 - 113
Fln protein:
K
Protein Length:
61
Fln nts:
C
Fln Alignment:
F51TW9002IDNUK___KFLKNGDAGFCLSMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKAVEKKEPSGAK
A9P004_______________KFLKNGDAGF-VKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKAVEKKDPTGAK

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta