UniGene Name: sp_v3.0_unigene52602
Length: 169 nt
UniGene Fasta |
---|
>sp_v3.0_unigene52602
A |
Ace file of the UniGene sp_v3.0_unigene52602 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Glycosyl hydrolase-like protein (Fragment) n=6 Tax=Picea sitchensis RepID=E0Z5X8_PICSI | - | - | 8.0e-11 | 97% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 97% |
Sma3 | Hydrolase, hydrolyzing O-glycosyl compounds, putative | - | - | 5.284e-11 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Beta-glucosidase. | EC:3.2.1.21 | - | 3.772e-15 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Cyanoamino acid metabolism | 00460 | 3.772e-15 | % | |
Sma3 | Starch and sucrose metabolism | 00500 | 3.772e-15 | % | |
Sma3 | Phenylpropanoid biosynthesis | 00940 | 3.772e-15 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 3.772e-15 | % |
Source | Gene names |
---|---|
Sma3 | At3g47000; At3g47000/F13I12.50; At3g47010; At5g04885; At5g20940; At5g20950; B1122D01.6; ExoI; F13I12.50; F13I12.60; GSVIVT00002637001; GSVIVT00017475001; GSVIVT00017476001; GSVIVT00024156001; GSVIVT00027100001; GSVIVT00030072001; LOC_Os03g53790; LOC_Os03g |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | plant-type cell wall | GO:0009505 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | anchored to membrane | GO:0031225 | Cellular Component | 0.0 | - |
Sma3 | glucan exo-1,3-beta-glucosidase activity | GO:0004338 | Molecular Function | 0.0 | - |
Sma3 | hydrolase activity, hydrolyzing O-glycosyl compounds | GO:0004553 | Molecular Function | 0.0 | - |
Sma3 | beta-glucosidase activity | GO:0008422 | Molecular Function | 0.0 | - |
Sma3 | carbohydrate metabolic process | GO:0005975 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Double-stranded RNA-binding | IPR001159 | - | 0.0 | - |
Sma3 | Aminoacyl-tRNA synthetase, class I, conserved site | IPR001412 | - | 0.0 | - |
Sma3 | Glycoside hydrolase, family 3, N-terminal | IPR001764 | - | 0.0 | - |
Sma3 | Glycoside hydrolase family 3 C-terminal domain | IPR002772 | - | 0.0 | - |
Sma3 | Double-stranded RNA-binding-like | IPR014720 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G04885.1 | Glycosyl hydrolase family protein chr5:1423369-1426628 FORWARD LENGTH=665 | 6.0e-15 | 88% |
RefSeq | Arabidopsis thaliana | NP_680141.2 | Glycosyl hydrolase family protein [Arabidopsis thaliana] | 8.0e-15 | 88% |
RefSeq | Populus trichocarpa | XP_002335769.1 | predicted protein, partial [Populus trichocarpa] | 1.0e-15 | 88% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NUD1
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 454 aas, your sequence is shorter than subject: 56 - 631
Fln protein:
A
Protein Length:
57
Fln nts:
A
Fln Alignment:
F51TW9002H7MFR___RDPDLARRIGAATALEVRATGIPYTFAPCVAVCR
A9NUD1_______________RDPDLARRIGAATALEVRATGIQYTFAPCVAVCR
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain