UniGene Name: sp_v3.0_unigene52599
Length: 148 nt
![]() |
---|
>sp_v3.0_unigene52599
T |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Respiratory burst oxidase homolog protein A n=4 Tax=Solanaceae RepID=RBOHA_SOLTU | - | - | 8.0e-12 | 77% |
FL-Next | sp=Respiratory burst oxidase homolog protein A; Solanum tuberosum (Potato). | - | - | 0.0 | 77% |
Sma3 | NADPH oxidase | - | - | 1.19e-15 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Oxidoreductases, Acting on a peroxide as acceptor, Peroxidases. | EC:1.11.1.- | - | 3.292e-11 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Glutathione metabolism | 00480 | 3.292e-11 | % | |
Sma3 | Oxidoreductases, Acting on NADH or NADPH, With a oxygen as acceptor. | EC:1.6.3.- | - | 8.513e-12 | - |
Sma3 | NAD(P)H oxidase. | EC:1.6.3.1 | - | 1.161e-11 | - |
Source | Gene names |
---|---|
Sma3 | At1g64060; At5g47910; B1060H01.16; F22C12.18; GSVIVT00002525001; GSVIVT00006235001; GSVIVT00016386001; GSVIVT00027665001; MCA23.25; NbrbohA; NbrbohB; OJ1187_E11.11; OSJNBb0036G09.27; Os01g0734200; Os05g0528000; OsI_03642; OsI_20707; OsJ_03364; OsJ_19284; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | peroxidase activity | GO:0004601 | Molecular Function | 0.0 | - |
Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
Sma3 | calcium ion binding | GO:0005509 | Molecular Function | 0.0 | - |
Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
Sma3 | NAD(P)H oxidase activity | GO:0016174 | Molecular Function | 0.0 | - |
Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
Sma3 | flavin adenine dinucleotide binding | GO:0050660 | Molecular Function | 0.0 | - |
Sma3 | oxidoreductase activity, acting on NADH or NADPH, oxygen as acceptor | GO:0050664 | Molecular Function | 0.0 | - |
Sma3 | respiratory burst involved in defense response | GO:0002679 | Biological Process | 0.0 | - |
Sma3 | oxygen and reactive oxygen species metabolic process | GO:0006800 | Biological Process | 0.0 | - |
Sma3 | response to heat | GO:0009408 | Biological Process | 0.0 | - |
Sma3 | abscisic acid mediated signaling pathway | GO:0009738 | Biological Process | 0.0 | - |
Sma3 | ethylene mediated signaling pathway | GO:0009873 | Biological Process | 0.0 | - |
Sma3 | regulation of stomatal movement | GO:0010119 | Biological Process | 0.0 | - |
Sma3 | negative regulation of programmed cell death | GO:0043069 | Biological Process | 0.0 | - |
Sma3 | hydrogen peroxide biosynthetic process | GO:0050665 | Biological Process | 0.0 | - |
Sma3 | defense response by callose deposition | GO:0052542 | Biological Process | 0.0 | - |
Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Cytochrome b245, heavy chain | IPR000778 | - | 0.0 | - |
Sma3 | Calcium-binding EF-hand | IPR002048 | - | 0.0 | - |
Sma3 | EF-hand-like domain | IPR011992 | - | 0.0 | - |
Sma3 | FAD-binding 8 | IPR013112 | - | 0.0 | - |
Sma3 | Ferric reductase, NAD binding | IPR013121 | - | 0.0 | - |
Sma3 | Flavoprotein transmembrane component | IPR013130 | - | 0.0 | - |
Sma3 | NADPH oxidase Respiratory burst | IPR013623 | - | 0.0 | - |
Sma3 | Ferredoxin reductase-type FAD-binding domain | IPR017927 | - | 0.0 | - |
Sma3 | EF-Hand 1, calcium-binding site | IPR018247 | - | 0.0 | - |
Sma3 | EF-hand | IPR018248 | - | 0.0 | - |
Sma3 | EF-HAND 2 | IPR018249 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G64060.1 | ATRBOH F, ATRBOHF, RBOHAP108, RBOHF, RBOH F respiratory burst oxidase protein F chr1:23770266-23776317 FORWARD LENGTH=944 | 4.0e-16 | 80% |
RefSeq | Arabidopsis thaliana | NP_564821.1 | respiratory burst oxidase [Arabidopsis thaliana] | 5.0e-16 | 80% |
RefSeq | Populus trichocarpa | XP_002326306.1 | predicted protein [Populus trichocarpa] | 1.0e-13 | 65% |
![]() |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q948U0
Fln msg: Distance to subject end: 398 aas, your sequence is shorter than subject: 49 - 963
Fln protein:
A
Protein Length:
50
Fln nts:
T
Fln Alignment:
F51TW9002F0RGV___LLSDFHGKQPTYLDLVKGVEGVTGIIMVILMIIAFTLATHWFRRN
Q948U0_______________LVNDFGPSQPQYIDLVKGVEGVTGIIMVILMAIAFTLATRWFRRS
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain