UniGene Name: sp_v3.0_unigene52565
Length: 227 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense) |
---|
>sp_v3.0_unigene52565
C |
Ace file of the UniGene sp_v3.0_unigene52565 (antisense) |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | DUF659 domain containing protein | - | - | 1.0e-11 | 67% |
FL-Next | tr=Putative uncharacterized protein; Vitis vinifera (Grape). | - | - | 0.0 | 59% |
Source | Gene names |
---|---|
Sma3 | GSVIVT00001874001; GSVIVT00002367001; GSVIVT00006112001; GSVIVT00010563001; GSVIVT00012114001; GSVIVT00013610001; GSVIVT00019252001; GSVIVT00022003001; GSVIVT00029960001; GSVIVT00031007001; GSVIVT00031053001; GSVIVT00033935001; GSVIVT00037342001; OSJNBa00 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
Sma3 | photosystem I | GO:0009522 | Cellular Component | 0.0 | - |
Sma3 | thylakoid | GO:0009579 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | protein dimerization activity | GO:0046983 | Molecular Function | 0.0 | - |
Sma3 | photosynthesis | GO:0015979 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Neuraxin/MAP1B repeat | IPR000102 | - | 0.0 | - |
Sma3 | Photosystem I PsaA/PsaB | IPR001280 | - | 0.0 | - |
Sma3 | Pumilio RNA-binding repeat | IPR001313 | - | 0.0 | - |
Sma3 | Zinc finger, CCHC-type | IPR001878 | - | 0.0 | - |
Sma3 | Polymorphic outer membrane protein repeat | IPR003368 | - | 0.0 | - |
Sma3 | Zinc finger, BED-type predicted | IPR003656 | - | 0.0 | - |
Sma3 | Domain of unknown function DUF659 | IPR007021 | - | 0.0 | - |
Sma3 | Zinc finger, C2H2 | IPR007087 | - | 0.0 | - |
Sma3 | HAT dimerisation | IPR008906 | - | 0.0 | - |
Sma3 | IPR011523 | - | 0.0 | - | |
Sma3 | Armadillo-like helical | IPR011989 | - | 0.0 | - |
Sma3 | Reverse transcriptase, RNA-dependent DNA polymerase | IPR013103 | - | 0.0 | - |
Sma3 | IPR015706 | - | 0.0 | - | |
Sma3 | Zinc finger, C2H2-like | IPR015880 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G22220.1 | hAT transposon superfamily chr3:7839808-7842358 REVERSE LENGTH=761 | 8.0e-18 | 49% |
RefSeq | Arabidopsis thaliana | NP_188861.2 | hAT dimerization domain-containing protein [Arabidopsis thaliana] | 1.0e-17 | 49% |
RefSeq | Populus trichocarpa | XP_002330517.1 | predicted protein [Populus trichocarpa] | 1.0e-19 | 53% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: tr_plants
Fln subject: A5BED6
Fln msg: Distance to subject end: 427 aas, your sequence is shorter than subject: 75 - 896
Fln protein:
F
Protein Length:
76
Fln nts:
C
Fln Alignment:
F51TW9002G2JXW___FWTPCAAH--DLMLEDIGKIDWVKNTIEHVKSITKYIYNHSWILNPMRKNTGGMDLVRLAIARFATHFLTLQSMFS
A5BED6_______________FWSACGAHCIDLMLEEIGKRDEVKELLAKAKRITQFIYNNTWVLNLTRKRTGGRDIVQLAITRFASNFLTLQSIVS
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain