UniGene Name: sp_v3.0_unigene52552
Length: 100 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene52552
G |
Ace file of the UniGene sp_v3.0_unigene52552
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | MYB8 transcription factor n=4 Tax=Pinaceae RepID=D7GLD4_PINPS | - | - | 4.0e-11 | 100% |
| FL-Next | tr=R2R3-MYB transcription factor MYB8; Pinus taeda (Loblolly pine). | - | - | 0.0 | 100% |
| Sma3 | R2r3-myb transcription factor, putative | - | - | 3.076e-16 | - |
| Source | Gene names |
|---|---|
| Sma3 | AT4g13480; At1g06180; At1g09540; At1g57557; At1g57560; At1g63910; At2g31180; At3g08500; At3g13890; At3g24310; At4g01680; At4g01680/T15B16.4; At4g13480; At5g12870; At5g26660; DcMYB1; F14J9.20; F21E10.4; F25P12.1; F9P14.4; GSVIVT00002546001; GSVIVT000160040 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | catalytic activity | GO:0003824 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | specific transcriptional repressor activity | GO:0016566 | Molecular Function | 0.0 | - |
| Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
| Sma3 | response to UV | GO:0009411 | Biological Process | 0.0 | - |
| Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
| Sma3 | phenylpropanoid biosynthetic process | GO:0009699 | Biological Process | 0.0 | - |
| Sma3 | response to ethylene stimulus | GO:0009723 | Biological Process | 0.0 | - |
| Sma3 | response to auxin stimulus | GO:0009733 | Biological Process | 0.0 | - |
| Sma3 | response to gibberellin stimulus | GO:0009739 | Biological Process | 0.0 | - |
| Sma3 | response to salicylic acid stimulus | GO:0009751 | Biological Process | 0.0 | - |
| Sma3 | response to jasmonic acid stimulus | GO:0009753 | Biological Process | 0.0 | - |
| Sma3 | secondary cell wall biogenesis | GO:0009834 | Biological Process | 0.0 | - |
| Sma3 | GO:0045449 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Inositol monophosphatase | IPR000760 | - | 0.0 | - |
| Sma3 | SANT/Myb domain | IPR001005 | - | 0.0 | - |
| Sma3 | Phosphoglycerate/bisphosphoglycerate mutase, active site | IPR001345 | - | 0.0 | - |
| Sma3 | IPR012287 | - | 0.0 | - | |
| Sma3 | IPR014778 | - | 0.0 | - | |
| Sma3 | Myb transcription factor | IPR015495 | - | 0.0 | - |
| Sma3 | Myb-like domain | IPR017877 | - | 0.0 | - |
| Sma3 | Myb domain, DNA-binding | IPR017930 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G09540.1 | MYB61, ATMYB61 myb domain protein 61 chr1:3086333-3087689 FORWARD LENGTH=366 | 2.0e-15 | 93% |
| RefSeq | Arabidopsis thaliana | NP_172425.2 | myb proto-oncogene protein [Arabidopsis thaliana] | 3.0e-15 | 93% |
| RefSeq | Populus trichocarpa | XP_002320929.1 | predicted protein [Populus trichocarpa] | 5.0e-15 | 93% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: Q27IP1
Fln msg: Distance to subject end: 452 aas, your sequence is shorter than subject: 32 - 534
Fln protein:
G
Protein Length:
33
Fln nts:
G
Fln Alignment:
F51TW9002GZDIV___GKSCRLRWINYLRPDLKRGTFSPQEENLIVEL
Q27IP1_______________GKSCRLRWINYLRPDLKRGTFSPQEENLIVEL

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta