UniGene Name: sp_v3.0_unigene52360
Length: 170 nt
UniGene Fasta |
---|
>sp_v3.0_unigene52360
A |
Ace file of the UniGene sp_v3.0_unigene52360 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Class III homeodomain leucine zipper protein n=18 Tax=Spermatophyta RepID=E7DX24_PICGL | - | - | 2.0e-15 | 86% |
FL-Next | tr=Class III homeodomain-leucine zipper protein C3HDZ1; Pseudotsuga menziesii (Douglas-fir) (Abies menziesii). | - | - | 0.0 | 86% |
Sma3 | Class III homeodomain-leucine zipper | - | - | 4.671e-20 | - |
Source | Gene names |
---|---|
Sma3 | AT1G52150; ATHB-15; ATHB-8; ATHB8; At1g52150; At4g32880; C3HDZ1; C3HDZ2; C3HDZ3; CNA; GSVIVT00032412001; GSVIVT00034328001; HB-3; HB1; HB10; HB2; HB3; HB5; HB6; HB7; HB8; HDZ31; HOX10; HOX32; HOX9; ICU4; LOC_Os03g01890; OsI_009462; OsI_012423; OsI_032907; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | sequence-specific DNA binding transcription factor activity | GO:0003700 | Molecular Function | 0.0 | - |
Sma3 | sequence-specific DNA binding | GO:0043565 | Molecular Function | 0.0 | - |
Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
Sma3 | positive regulation of cell proliferation | GO:0008284 | Biological Process | 0.0 | - |
Sma3 | response to auxin stimulus | GO:0009733 | Biological Process | 0.0 | - |
Sma3 | meristem initiation | GO:0010014 | Biological Process | 0.0 | - |
Sma3 | primary shoot apical meristem specification | GO:0010072 | Biological Process | 0.0 | - |
Sma3 | xylem development | GO:0010089 | Biological Process | 0.0 | - |
Sma3 | positive regulation of cell differentiation | GO:0045597 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Homeodomain | IPR001356 | - | 0.0 | - |
Sma3 | Lipid-binding START | IPR002913 | - | 0.0 | - |
Sma3 | Basic-leucine zipper domain | IPR004827 | - | 0.0 | - |
Sma3 | Phosphopantetheine attachment site | IPR006162 | - | 0.0 | - |
Sma3 | IPR012287 | - | 0.0 | - | |
Sma3 | MEKHLA | IPR013978 | - | 0.0 | - |
Sma3 | Homeobox, conserved site | IPR017970 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G32880.1 | ATHB-8, ATHB8, HB-8 homeobox gene 8 chr4:15863587-15867822 REVERSE LENGTH=833 | 1.0e-15 | 68% |
RefSeq | Arabidopsis thaliana | NP_195014.1 | homeobox-leucine zipper protein ATHB-8 [Arabidopsis thaliana] | 1.0e-15 | 68% |
RefSeq | Populus trichocarpa | XP_002336921.1 | hypothetical protein POPTRDRAFT_292259, partial [Populus trichocarpa] | 4.0e-18 | 74% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: Q20BK7
Fln msg: Distance to subject end: 507 aas, your sequence is shorter than subject: 56 - 842
Fln protein:
V
Protein Length:
57
Fln nts:
A
Fln Alignment:
F51TW9002J5V97___VLEDGSLVVCERSLSGTQGGPSIPPVQHFVRAVNASPVDILIQPCEGGGS
Q20BK7_______________VLEDGSLVVCERSLSGTQGGPSIPPVQHFVRA-EMLPSGYLIQPCEGGGS
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain