UniGene Name: sp_v3.0_unigene52301
Length: 228 nt
UniGene Fasta |
---|
>sp_v3.0_unigene52301
A |
Ace file of the UniGene sp_v3.0_unigene52301 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | similar to pol polyprotein | - | - | 3.0e-15 | 56% |
FL-Next | sp=RNA-directed DNA polymerase homolog; berteroana). Mitochondrion. | - | - | 0.0 | 43% |
Sma3 | Retrotransposon protein, putative, Ty3-gypsy subclass | - | - | 2.116e-06 | - |
Source | Gene names |
---|---|
Sma3 | CTV.20; GSVIVT00000881001; H0315A08.1; LOC_Os10g18670; LOC_Os10g27260; LOC_Os10g40804; LOC_Os12g08880; LOC_Os12g42720; OSJNBa0006B20.7; OSJNBa0017B10.4; Os02g0255400; VITISV_008274; VITISV_010133; VITISV_015783; VITISV_016584; VITISV_018870; VITISV_020611 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | transcription cofactor activity | GO:0003712 | Molecular Function | 0.0 | - |
Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
Sma3 | cysteine-type peptidase activity | GO:0008234 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
Sma3 | transport | GO:0006810 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Reverse transcriptase | IPR000477 | - | 0.0 | - |
Sma3 | Tobamoviral movement protein | IPR001022 | - | 0.0 | - |
Sma3 | Flavin amine oxidase | IPR001613 | - | 0.0 | - |
Sma3 | Zinc finger, CCHC-type | IPR001878 | - | 0.0 | - |
Sma3 | Peptidase aspartic, active site | IPR001969 | - | 0.0 | - |
Sma3 | Amine oxidase | IPR002937 | - | 0.0 | - |
Sma3 | Peptidase C48, SUMO/Sentrin/Ubl1 | IPR003653 | - | 0.0 | - |
Sma3 | Transposon, En/Spm-like | IPR004242 | - | 0.0 | - |
Sma3 | IPR013084 | - | 0.0 | - | |
Sma3 | NAD(P)-binding domain | IPR016040 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
RefSeq | Populus trichocarpa | XP_002300438.1 | predicted protein [Populus trichocarpa] | 5.0e-19 | 52% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: P31843
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 49 aas, your sequence is shorter than subject: 73 - 142
Fln protein:
M
Protein Length:
74
Fln nts:
A
Fln Alignment:
F51TW9002JVG7D___YPIPHKGDLIKRIAGAKIFCKFDLKAGFWQVAIGEKDKFKTAFSITAGHYDWNMMPFGPKNAPSKF
P31843_______________YPIPRVDDLFDRLAQATWFTKLDLRSGYWQVRIAKGDEPKTTCVTRYGSFEFRVMPFGLTNALATF
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain