UniGene Name: sp_v3.0_unigene52254
Length: 204 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene52254
G |
Ace file of the UniGene sp_v3.0_unigene52254
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Glycosyl hydrolase (Fragment) n=8 Tax=Picea RepID=F1C902_PICAB | - | - | 2.0e-14 | 76% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 82% |
| Sma3 | Glucan endo-1,3-beta-glucosidase 7 | - | - | 8.099e-14 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Glucan endo-1,3-beta-D-glucosidase. | EC:3.2.1.39 | - | 9.645e-11 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Starch and sucrose metabolism | 00500 | 9.645e-11 | % |
| Source | Gene names |
|---|---|
| Sma3 | At1g30080; At1g32860; At5g42100; B1110B01.17; F9L11.6; GSVIVT00000495001; GSVIVT00028303001; GSVIVT00037350001; H0717B12.10; LOC_Os03g14210; LOC_Os10g07290; MJC20.21; OSIGBa0134P10.1; OSJNBa0020H14.13; OSJNBa0050E08.13; OSJNBa0073L04.8; Os01g0860800; Os02 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | extracellular region | GO:0005576 | Cellular Component | 0.0 | - |
| Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
| Sma3 | endoplasmic reticulum | GO:0005783 | Cellular Component | 0.0 | - |
| Sma3 | plant-type cell wall | GO:0009505 | Cellular Component | 0.0 | - |
| Sma3 | plasmodesma | GO:0009506 | Cellular Component | 0.0 | - |
| Sma3 | anchored to membrane | GO:0031225 | Cellular Component | 0.0 | - |
| Sma3 | anchored to plasma membrane | GO:0046658 | Cellular Component | 0.0 | - |
| Sma3 | hydrolase activity, hydrolyzing O-glycosyl compounds | GO:0004553 | Molecular Function | 0.0 | - |
| Sma3 | glucan endo-1,3-beta-D-glucosidase activity | GO:0042973 | Molecular Function | 0.0 | - |
| Sma3 | cation binding | GO:0043169 | Molecular Function | 0.0 | - |
| Sma3 | carbohydrate metabolic process | GO:0005975 | Biological Process | 0.0 | - |
| Sma3 | defense response | GO:0006952 | Biological Process | 0.0 | - |
| Sma3 | cellular cell wall organization | GO:0007047 | Biological Process | 0.0 | - |
| Sma3 | cell communication | GO:0007154 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Peptidase, cysteine peptidase active site | IPR000169 | - | 0.0 | - |
| Sma3 | Glycoside hydrolase, family 17 | IPR000490 | - | 0.0 | - |
| Sma3 | Histone H2A | IPR002119 | - | 0.0 | - |
| Sma3 | TonB box, conserved site | IPR010916 | - | 0.0 | - |
| Sma3 | X8 | IPR012946 | - | 0.0 | - |
| Sma3 | Glycoside hydrolase, subgroup, catalytic domain | IPR013781 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G30080.1 | Glycosyl hydrolase superfamily protein chr1:10551231-10553167 REVERSE LENGTH=408 | 2.0e-17 | 71% |
| RefSeq | Arabidopsis thaliana | NP_174300.2 | glycosyl hydrolases family 17 domain-containing protein [Arabidopsis thaliana] | 2.0e-17 | 71% |
| RefSeq | Populus trichocarpa | XP_002306003.1 | predicted protein, partial [Populus trichocarpa] | 6.0e-18 | 71% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LR54
Fln msg: Distance to subject end: 63 aas, your sequence is shorter than subject: 67 - 435
Fln protein:
A
Protein Length:
68
Fln nts:
G
Fln Alignment:
F51TW9002II9H1___AQNQGTPLRPEVFVFCQAYLFALFNEDMKPGPTSERNYGLYKPDGTEVYN
B8LR54_______________AQNQGTPLRPKLVL--QAYLFALFNEDMKPGPASERNYGLFKPDGTAVYN

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta