UniGene Name: sp_v3.0_unigene52177
Length: 185 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene52177
T |
Ace file of the UniGene sp_v3.0_unigene52177 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Putative 2-cys peroxiredoxin (Fragment) n=1 Tax=Lemna minor RepID=C7DRS6_LEMMI | - | - | 2.0e-25 | 95% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 95% |
| Sma3 | Thioredoxin peroxidase | - | - | 7.442e-16 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Oxidoreductases, Acting on a peroxide as acceptor, Peroxidases. | EC:1.11.1.- | - | 7.301e-06 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Glutathione metabolism | 00480 | 7.301e-06 | % | |
| Sma3 | Peroxiredoxin. | EC:1.11.1.15 | - | 7.013e-19 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Glutathione metabolism | 00480 | 7.013e-19 | % | |
| Sma3 | Metabolic pathways | 01100 | 7.013e-19 | % |
| Source | Gene names |
|---|---|
| Sma3 | 2-Cys PRx; At3g11630; At5g06290; BAS1; C2C-Prx; CHLREDRAFT_108953; CHLREDRAFT_142363; CHLREDRAFT_155464; F24K9.28; GSVIVT00021525001; Grc000117; Heak293_Cp051; LOC_Os02g33450; MHF15.19; MICPUCDRAFT_49495; MICPUN_109516; OJ991214_12.15; OSIGBa0092M08.6; OS |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast stroma | GO:0009570 | Cellular Component | 0.0 | - |
| Sma3 | thylakoid | GO:0009579 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
| Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
| Sma3 | peroxidase activity | GO:0004601 | Molecular Function | 0.0 | - |
| Sma3 | antioxidant activity | GO:0016209 | Molecular Function | 0.0 | - |
| Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
| Sma3 | peroxiredoxin activity | GO:0051920 | Molecular Function | 0.0 | - |
| Sma3 | response to cold | GO:0009409 | Biological Process | 0.0 | - |
| Sma3 | defense response to bacterium | GO:0042742 | Biological Process | 0.0 | - |
| Sma3 | cell redox homeostasis | GO:0045454 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Alkyl hydroperoxide reductase subunit C/ Thiol specific antioxidant | IPR000866 | - | 0.0 | - |
| Sma3 | IPR012335 | - | 0.0 | - | |
| Sma3 | IPR017936 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G06290.1 | 2-Cys Prx B, 2CPB 2-cysteine peroxiredoxin B chr5:1919380-1921211 FORWARD LENGTH=273 | 4.0e-33 | 90% |
| RefSeq | Arabidopsis thaliana | NP_568166.1 | 2-Cys peroxiredoxin BAS1-like protein [Arabidopsis thaliana] | 5.0e-33 | 90% |
| RefSeq | Populus trichocarpa | XP_002323394.1 | 2-cys peroxiredoxin [Populus trichocarpa] | 1.0e-31 | 86% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NRA2
Fln msg: Distance to subject end: 101 aas, your sequence is shorter than subject: 61 - 282
Fln protein:
Y
Protein Length:
62
Fln nts:
T
Fln Alignment:
F51TW9001AKYDL___YVILFFYPLDFTFVCPTGEITAFSDRYSEFEKLNTEILGVSIDSVFSHLAWVQTERKAGGL
A9NRA2_______________YVILFFYPLDFTFVCPT-EITAFSDRHSEFEKLNTEILGVSIDSVFSHLAWVQTDRKAGGL

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta (sense)