|
||||||
|
UniGene Name: sp_v3.0_unigene52162
Length: 223 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
 UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene52162
A |
|
Ace file of the UniGene sp_v3.0_unigene52162 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | RNA-directed DNA polymerase (Reverse transcriptase); Ribonuclease H n=2 Tax=Medicago truncatula RepID=A2Q2J0_MEDTR | - | - | 3.0e-20 | 61% |
| FL-Next | sp=RNA-directed DNA polymerase homolog; berteroana). Mitochondrion. | - | - | 0.0 | 39% |
| Sma3 | Reverse transcriptase | - | - | 1.039e-08 | - |
| Source | Gene names |
|---|---|
| Sma3 | 19.t00011; 19.t00014; 19.t00017; 20.t00014; 20.t00044; AT4g07600; AT4g07660; At2g14040; GSVIVT00000833001; GSVIVT00005536001; LOC_Os03g41624; MtrDRAFT_AC147774g2v1; MtrDRAFT_AC150891g48v2; OJ1045_C06.5; OSJNBa0036C12.21; OSJNBb0007E22.28; OSJNBb0026I12.3; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
| Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
| Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
| Sma3 | ribonuclease H activity | GO:0004523 | Molecular Function | 0.0 | - |
| Sma3 | ferric iron binding | GO:0008199 | Molecular Function | 0.0 | - |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
| Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
| Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
| Sma3 | cellular iron ion homeostasis | GO:0006879 | Biological Process | 0.0 | - |
| Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | G-patch domain | IPR000467 | - | 0.0 | - |
| Sma3 | Reverse transcriptase | IPR000477 | - | 0.0 | - |
| Sma3 | Integrase, catalytic core | IPR001584 | - | 0.0 | - |
| Sma3 | Zinc finger, CCHC-type | IPR001878 | - | 0.0 | - |
| Sma3 | Protein translocase complex, SecE/Sec61-gamma subunit | IPR001901 | - | 0.0 | - |
| Sma3 | Peptidase aspartic, active site | IPR001969 | - | 0.0 | - |
| Sma3 | Ribonuclease H domain | IPR002156 | - | 0.0 | - |
| Sma3 | KID repeat | IPR003900 | - | 0.0 | - |
| Sma3 | Retrotransposon gag protein | IPR005162 | - | 0.0 | - |
| Sma3 | Inorganic pyrophosphatase | IPR008162 | - | 0.0 | - |
| Sma3 | Ferritin/DPS protein domain | IPR008331 | - | 0.0 | - |
| Sma3 | Ferritin- like diiron domain | IPR009040 | - | 0.0 | - |
| Sma3 | Beta tubulin, autoregulation binding site | IPR013838 | - | 0.0 | - |
| Sma3 | Ferritin, conserved site | IPR014034 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| RefSeq | Populus trichocarpa | XP_002336419.1 | predicted protein, partial [Populus trichocarpa] | 3.0e-13 | 80% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: P31843
Fln msg: Distance to subject end: 46 aas, your sequence is shorter than subject: 73 - 142
Fln protein:
N
Protein Length:
74
Fln nts:
A
Fln Alignment:
F51TW9001AR9J5___YPLPKMDLMLQNIVGSQRMSMLDGFSGYNQILVHPEDQEKTTFTTPWGTFMYAKMPFGLMNAGATFQRAMD
P31843_______________YPIPRVDDLFDRLAQATWFTKLDLRSGYWQVRIAKGDEPKTTCVTRYGSFEFRVMPFGLTNALATFCNLMN
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
