UniGene Name: sp_v3.0_unigene52012
Length: 212 nt
![]() |
---|
>sp_v3.0_unigene52012
T |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Repressor of silencing 1 n=1 Tax=Nicotiana tabacum RepID=A4PF88_TOBAC | - | - | 8.0e-30 | 85% |
FL-Next | Isoform 2 of Transcriptional activator DEMETER OS=Arabidopsis thaliana GN=DME | - | - | 0.0 | 79% |
Sma3 | Repressor of silencing 1 | - | - | 1.712e-08 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Hydrolases, Glycosylases, Hydrolyzing N-glycosyl compounds. | EC:3.2.2.- | - | 8.825e-13 | - |
Source | Gene names |
---|---|
Sma3 | At2g36490; At3g10010; At4g04957; At4g34060; At5g04560/At5g04570/At5g04580; DME; DML1; DML2; DML3; DNG1501; DNG701; DNG901; DNG902; F1O11.12; F28A23.180; GSVIVT00021675001; GSVIVT00022089001; GSVIVT00034990001; NtROS1; OJ1288_D09.7; Os01g0217900; Os02g0496 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | catalytic activity | GO:0003824 | Molecular Function | 0.0 | - |
Sma3 | DNA-(apurinic or apyrimidinic site) lyase activity | GO:0003906 | Molecular Function | 0.0 | - |
Sma3 | endonuclease activity | GO:0004519 | Molecular Function | 0.0 | - |
Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | DNA N-glycosylase activity | GO:0019104 | Molecular Function | 0.0 | - |
Sma3 | 4 iron, 4 sulfur cluster binding | GO:0051539 | Molecular Function | 0.0 | - |
Sma3 | DNA repair | GO:0006281 | Biological Process | 0.0 | - |
Sma3 | base-excision repair | GO:0006284 | Biological Process | 0.0 | - |
Sma3 | DNA methylation | GO:0006306 | Biological Process | 0.0 | - |
Sma3 | regulation of gene expression by genetic imprinting | GO:0006349 | Biological Process | 0.0 | - |
Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
Sma3 | embryo development ending in seed dormancy | GO:0009793 | Biological Process | 0.0 | - |
Sma3 | maintenance of DNA methylation | GO:0010216 | Biological Process | 0.0 | - |
Sma3 | negative regulation of chromatin silencing | GO:0031936 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | HhH-GPD domain | IPR003265 | - | 0.0 | - |
Sma3 | Endonuclease III-like, iron-sulphur cluster loop motif | IPR003651 | - | 0.0 | - |
Sma3 | Endonuclease III, iron-sulphur binding site | IPR004035 | - | 0.0 | - |
Sma3 | Domain of unknown function DUF1985 | IPR015410 | - | 0.0 | - |
Sma3 | AT hook, DNA-binding motif | IPR017956 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G04560.2 | DME HhH-GPD base excision DNA repair family protein chr5:1309786-1318091 FORWARD LENGTH=1987 | 2.0e-33 | 79% |
RefSeq | Arabidopsis thaliana | NP_196076.2 | transcriptional activator DEMETER [Arabidopsis thaliana] | 3.0e-33 | 79% |
RefSeq | Populus trichocarpa | XP_002326244.1 | DNA glycosylase, partial [Populus trichocarpa] | 3.0e-38 | 83% |
![]() |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q8LK56-2
Fln msg: Distance to subject end: 32 aas, your sequence is shorter than subject: 70 - 674
Fln protein:
M
Protein Length:
71
Fln nts:
T
Fln Alignment:
F51TW9001CWRHL___RGSFPLNGTYFQVNEVFADHETSLNPIEVPRSWIWRLTRRTVYFGTSIPTIFRGLTTEVIQQCFWRGF
Q8LK56-2_____________RGSFPLNGTYFQVNELFADHESSLKPIDVPRDWIWDLPRRTVYFGTSVTSIFRGLSTEQIQFCFWKGF
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain