SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene52012

Length: 212 nt

UniGene Fasta

>sp_v3.0_unigene52012
TATGGGGCGAGGCAGCTTCCCACTTAATGGAACCTATTTCCAAGTTAATGAGGTATTTGCCGACCATGAAACAAGTTTAAATCCAATTGAAGTCCCAAGATCTTGGATTTGGCGTTTGACACGTCGTACAGTTTATTTTGGTACCTCTATTCCAACAATTTTTCGAGGTCTTACCACTGAGGTGATTCAACAATGCTTTTGGAGAGGTTTTG

Ace file of the UniGene sp_v3.0_unigene52012

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Repressor of silencing 1 n=1 Tax=Nicotiana tabacum RepID=A4PF88_TOBAC	-	-	8.0e-30	85%
FL-Next	Isoform 2 of Transcriptional activator DEMETER OS=Arabidopsis thaliana GN=DME	-	-	0.0	79%
Sma3	Repressor of silencing 1	-	-	1.712e-08	-

Source	ECs	Term	Type	e value	Identity
Sma3	Hydrolases, Glycosylases, Hydrolyzing N-glycosyl compounds.	EC:3.2.2.-	-	8.825e-13	-

Source	Gene names
Sma3	At2g36490; At3g10010; At4g04957; At4g34060; At5g04560/At5g04570/At5g04580; DME; DML1; DML2; DML3; DNG1501; DNG701; DNG901; DNG902; F1O11.12; F28A23.180; GSVIVT00021675001; GSVIVT00022089001; GSVIVT00034990001; NtROS1; OJ1288_D09.7; Os01g0217900; Os02g0496

Source	GOs	Term	Type	Identity
Sma3	nucleus	GO:0005634	Cellular Component	-
Sma3	DNA binding	GO:0003677	Molecular Function	-
Sma3	catalytic activity	GO:0003824	Molecular Function	-
Sma3	DNA-(apurinic or apyrimidinic site) lyase activity	GO:0003906	Molecular Function	-
Sma3	endonuclease activity	GO:0004519	Molecular Function	-
Sma3	iron ion binding	GO:0005506	Molecular Function	-
Sma3	protein binding	GO:0005515	Molecular Function	-
Sma3	DNA N-glycosylase activity	GO:0019104	Molecular Function	-
Sma3	4 iron, 4 sulfur cluster binding	GO:0051539	Molecular Function	-
Sma3	DNA repair	GO:0006281	Biological Process	-
Sma3	base-excision repair	GO:0006284	Biological Process	-
Sma3	DNA methylation	GO:0006306	Biological Process	-
Sma3	regulation of gene expression by genetic imprinting	GO:0006349	Biological Process	-
Sma3	regulation of transcription, DNA-dependent	GO:0006355	Biological Process	-
Sma3	embryo development ending in seed dormancy	GO:0009793	Biological Process	-
Sma3	maintenance of DNA methylation	GO:0010216	Biological Process	-
Sma3	negative regulation of chromatin silencing	GO:0031936	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	HhH-GPD domain	IPR003265	-	-
Sma3	Endonuclease III-like, iron-sulphur cluster loop motif	IPR003651	-	-
Sma3	Endonuclease III, iron-sulphur binding site	IPR004035	-	-
Sma3	Domain of unknown function DUF1985	IPR015410	-	-
Sma3	AT hook, DNA-binding motif	IPR017956	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT5G04560.2	DME HhH-GPD base excision DNA repair family protein chr5:1309786-1318091 FORWARD LENGTH=1987	2.0e-33	79%
RefSeq	Arabidopsis thaliana	NP_196076.2	transcriptional activator DEMETER [Arabidopsis thaliana]	3.0e-33	79%
RefSeq	Populus trichocarpa	XP_002326244.1	DNA glycosylase, partial [Populus trichocarpa]	3.0e-38	83%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: sp_plants

Fln subject: Q8LK56-2

Fln msg: Distance to subject end: 32 aas, your sequence is shorter than subject: 70 - 674

Fln protein: MGRGSFPLNGTYFQVNEVFADHETSLNPIEVPRSWIWRLTRRTVYFGTSIPTIFRGLTTEVIQQCFWRGF

Protein Length: 71

Fln nts: TATGGGGCGAGGCAGCTTCCCACTTAATGGAACCTATTTCCAAGTTAATGAGGTATTTGCCGACCATGAAACAAGTTTAAATCCAATTGAAGTCCCAAGATCTTGGATTTGGCGTTTGACACGTCGTACAGTTTATTTTGGTACCTCTATTCCAACAATTTTTCGAGGTCTTACCACTGAGGTGATTCAACAATGCTTTTGGAGAGGTTTTG

Fln Alignment:

F51TW9001CWRHL___RGSFPLNGTYFQVNEVFADHETSLNPIEVPRSWIWRLTRRTVYFGTSIPTIFRGLTTEVIQQCFWRGF
Q8LK56-2_____________RGSFPLNGTYFQVNELFADHESSLKPIDVPRDWIWDLPRRTVYFGTSVTSIFRGLSTEQIQFCFWKGF

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain