UniGene Name: sp_v3.0_unigene51944
Length: 212 nt
![]() |
---|
>sp_v3.0_unigene51944
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Putative polyprotein n=2 Tax=Oryza sativa Japonica Group RepID=Q851Y3_ORYSJ | - | - | 2.0e-16 | 58% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 55% |
Sma3 | Retrotransposon protein, putative, Ty1-copia subclass | - | - | 2.393e-08 | - |
Source | Gene names |
---|---|
Sma3 | B0809H07.1; LOC_Os03g13700; LOC_Os03g22970; LOC_Os03g24260; LOC_Os03g25890; LOC_Os10g08740; LOC_Os10g10380; LOC_Os10g19064; LOC_Os10g21950; LOC_Os11g35630; LOC_Os11g36590; LOC_Os11g37710; LOC_Os11g44530; LOC_Os11g44780; LOC_Os11g47470; LOC_Os12g19760; OJ1 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | alpha-mannosidase activity | GO:0004559 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | ATP-dependent helicase activity | GO:0008026 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | ATPase activity | GO:0016887 | Molecular Function | 0.0 | - |
Sma3 | nucleoside-triphosphatase activity | GO:0017111 | Molecular Function | 0.0 | - |
Sma3 | carbohydrate binding | GO:0030246 | Molecular Function | 0.0 | - |
Sma3 | mannose metabolic process | GO:0006013 | Biological Process | 0.0 | - |
Sma3 | apoptotic process | GO:0006915 | Biological Process | 0.0 | - |
Sma3 | defense response | GO:0006952 | Biological Process | 0.0 | - |
Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G23160.1 | CRK8 cysteine-rich RLK (RECEPTOR-like protein kinase) 8 chr4:12129485-12134086 FORWARD LENGTH=1262 | 6.0e-17 | 47% |
RefSeq | Arabidopsis thaliana | NP_194047.2 | cysteine-rich receptor-like protein kinase 8 [Arabidopsis thaliana] | 7.0e-17 | 47% |
![]() |
---|
Fln status: Putative N-terminus
Fln database: coniferopsida.fasta
Fln subject: B8LKV8
Fln msg: Distance to subject end: 280 aas, atg_distance in limit (1-15): atg_distance = 14, W2: There is no M at the beginning, your sequence is shorter than subject: 70 - 363
Fln protein:
W
Protein Length:
71
Fln nts:
_
Fln Alignment:
F51TW9001A3TU6___WDLVPLPKERKLVRCKWVYKTKFGPDGKVDKHKTCLVAKGF*QVEGIDYTETFSLVAKKNSICHLLSLAA
B8LKV8_______________WDLVDLPKEKECISVKWVYKTKYKANGELDKHKARLVAKGFAQEYGVDYNETFAPVARLDTIRMVLAIAA
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain