UniGene Name: sp_v3.0_unigene51924
Length: 182 nt
![]() |
---|
>sp_v3.0_unigene51924
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Unassigned protein | - | - | 0.0 | - |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 64% |
Sma3 | Putative pentatricopeptide (PPR) repeat-containing protein | - | - | 1.941e-07 | - |
Source | Gene names |
---|---|
Sma3 | At1g15510; At1g74600; At3g11460; At3g26782; At5g08510; At5g66520; B1032F05.19; F1M20.28; F24K9.13; F8L15.21; GSVIVT00000293001; GSVIVT00001706001; GSVIVT00002423001; GSVIVT00002920001; GSVIVT00004379001; GSVIVT00006467001; GSVIVT00006516001; GSVIVT0000697 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | ubiquitin thiolesterase activity | GO:0004221 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | methyltransferase activity | GO:0008168 | Molecular Function | 0.0 | - |
Sma3 | deaminase activity | GO:0019239 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | ubiquitin-dependent protein catabolic process | GO:0006511 | Biological Process | 0.0 | - |
Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
Sma3 | purine ribonucleoside monophosphate biosynthetic process | GO:0009168 | Biological Process | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G08510.1 | Pentatricopeptide repeat (PPR) superfamily protein chr5:2753099-2754731 FORWARD LENGTH=511 | 2.0e-16 | 60% |
RefSeq | Arabidopsis thaliana | NP_196468.1 | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] | 3.0e-16 | 60% |
RefSeq | Populus trichocarpa | XP_002308737.1 | predicted protein [Populus trichocarpa] | 1.0e-17 | 60% |
![]() |
---|
Fln status: Putative C-terminus
Fln database: coniferopsida.fasta
Fln subject: D5AB53
Fln msg: STOP codon was not found. Distance to subject end: 2 aas, your sequence is shorter than subject: 60 - 232
Fln protein:
C
Protein Length:
61
Fln nts:
A
Fln Alignment:
F51TW9001ALB5A___CCMVDLLGRAGHLGEAHDFINQMPMDPDATVWGSLLGACRIYINVELGEHATKCPFTVG
D5AB53_______________CCMVDLLGRTGCLDEAHDFINKMPIEPDTAVWQSLLGACRTHANVDLGEKVAERLSNVG
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain