|
||||||
|
UniGene Name: sp_v3.0_unigene51851
Length: 165 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene51851
A |
|
Ace file of the UniGene sp_v3.0_unigene51851
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | vacuolar cation/proton exchanger 2 [Arabidopsis thaliana] sp|Q39254.2|CAX2_ARATH RecName: Full=Vacuolar cation/proton exchanger 2; AltName: Full=Ca(2+)/H(+) antiporter CAX2; AltName: Full=Ca(2+)/H(+) exchanger 2 gb|AAL11621.1|AF424628_1 AT3g13320/MDC11_10 | - | - | 2.0e-11 | 66% |
| FL-Next | sp=Vacuolar cation/proton exchanger 2; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 66% |
| Sma3 | Vacuolar cation/proton exchanger, putative | - | - | 2.011e-12 | - |
| Source | Gene names |
|---|---|
| Sma3 | At1g55720; At1g55730; At3g13320; CAX2; CAX5; CAX6; F20N2.13; F20N2.23; GSVIVT00029044001; GSVIVT00033462001; LOC_Os02g04630; LOC_Os03g27960; MDC11.10; MDC11.19; OSJNBa0026E05.30; Os02g0138900; Os03g0397400; OsI_05783; OsJ_05313; PHYPADRAFT_129850; PHYPADR |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | vacuolar membrane | GO:0005774 | Cellular Component | 0.0 | - |
| Sma3 | plant-type vacuole membrane | GO:0009705 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | calcium ion binding | GO:0005509 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | cation transmembrane transporter activity | GO:0008324 | Molecular Function | 0.0 | - |
| Sma3 | antiporter activity | GO:0015297 | Molecular Function | 0.0 | - |
| Sma3 | calcium:hydrogen antiporter activity | GO:0015369 | Molecular Function | 0.0 | - |
| Sma3 | cation transport | GO:0006812 | Biological Process | 0.0 | - |
| Sma3 | calcium ion transport | GO:0006816 | Biological Process | 0.0 | - |
| Sma3 | manganese ion transport | GO:0006828 | Biological Process | 0.0 | - |
| Sma3 | cadmium ion transport | GO:0015691 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Calcium/proton exchanger | IPR004713 | - | 0.0 | - |
| Sma3 | Calcium/proton exchanger superfamily | IPR004798 | - | 0.0 | - |
| Sma3 | Sodium/calcium exchanger membrane region | IPR004837 | - | 0.0 | - |
| Sma3 | Phosphopantetheine attachment site | IPR006162 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G13320.1 | CAX2, atcax2 cation exchanger 2 chr3:4315418-4317997 FORWARD LENGTH=441 | 4.0e-16 | 66% |
| RefSeq | Arabidopsis thaliana | NP_566452.1 | vacuolar cation/proton exchanger 2 [Arabidopsis thaliana] | 5.0e-16 | 66% |
| RefSeq | Populus trichocarpa | XP_002299069.1 | Ca2+ antiporter/cation exchanger, partial [Populus trichocarpa] | 4.0e-15 | 64% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q39254
Fln msg: Distance to subject end: 182 aas, your sequence is shorter than subject: 54 - 441
Fln protein:
G
Protein Length:
55
Fln nts:
A
Fln Alignment:
F51TW9001EHT8S___GPTFPSFLVLHYTHTELHVGKSELSLSRFSSCVMLVAYVFYLVFQLKSHRN
Q39254_______________GILFPA--VLHYTHSEVHAGSSELALSRFSSCIMLIAYAAYLFFQLKSQSN
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
