UniGene Name: sp_v3.0_unigene51841
Length: 240 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
![]() |
---|
>sp_v3.0_unigene51841
T |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | RVT_2 domain containing protein | - | - | 2.0e-27 | 53% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 59% |
Sma3 | Retrotransposon protein, putative, Ty1-copia subclass | - | - | 9.67e-13 | - |
Source | Gene names |
---|---|
Sma3 | LOC_Os03g20080; LOC_Os03g36610; LOC_Os03g56990; LOC_Os03g64080; LOC_Os11g07980; LOC_Os12g26180; LOC_Os12g30600; OSJNBa0084C09.6; OSJNBa0091J19.18; OSJNBa0096I06.16; OSJNBb0093E13.7; OSJNOa0153K02.4; SDM1_27t00018; VITISV_006720; VITISV_011263; VITISV_0221 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nuclear pore | GO:0005643 | Cellular Component | 0.0 | - |
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | protein transporter activity | GO:0008565 | Molecular Function | 0.0 | - |
Sma3 | protein dimerization activity | GO:0046983 | Molecular Function | 0.0 | - |
Sma3 | protein import into nucleus, docking | GO:0000059 | Biological Process | 0.0 | - |
Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Reverse transcriptase | IPR000477 | - | 0.0 | - |
Sma3 | Importin-beta, N-terminal | IPR001494 | - | 0.0 | - |
Sma3 | Integrase, catalytic core | IPR001584 | - | 0.0 | - |
Sma3 | Zinc finger, CCHC-type | IPR001878 | - | 0.0 | - |
Sma3 | Ankyrin repeat | IPR002110 | - | 0.0 | - |
Sma3 | Retrotransposon gag protein | IPR005162 | - | 0.0 | - |
Sma3 | HAT dimerisation | IPR008906 | - | 0.0 | - |
Sma3 | Armadillo-like helical | IPR011989 | - | 0.0 | - |
Sma3 | Reverse transcriptase, RNA-dependent DNA polymerase | IPR013103 | - | 0.0 | - |
Sma3 | Exportin-1/Importin-beta-like | IPR013598 | - | 0.0 | - |
Sma3 | CRM1 C-terminal domain | IPR014877 | - | 0.0 | - |
Sma3 | IPR015706 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | ATMG00820.1 | ORF170 Reverse transcriptase (RNA-dependent DNA polymerase) chrM:228573-229085 REVERSE LENGTH=170 | 2.0e-19 | 49% |
RefSeq | Arabidopsis thaliana | NP_085538.1 | hypothetical protein ArthMp071 (mitochondrion) [Arabidopsis thaliana] | 3.0e-19 | 49% |
![]() |
---|
Fln status: Putative N-terminus
Fln database: coniferopsida.fasta
Fln subject: B8LKV8
Fln msg: Distance to subject end: 272 aas, atg_distance in limit (1-15): atg_distance = 12, W2: There is no M at the beginning, your sequence is shorter than subject: 79 - 363
Fln protein:
G
Protein Length:
80
Fln nts:
T
Fln Alignment:
F51TW9001DE723___TWKLVDPPLGTKPIGCKWVIENKYKADGSLDKHKARFVAKGFA*KEGVNYEETFSPIAKWATIQ
B8LKV8_______________TWDLVDLPKEKECISVKWVYKTKYKANGELDKHKARLVAKGFAQEYGVDYNETFAPVARLDTIR
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain