UniGene Name: sp_v3.0_unigene51785
Length: 201 nt
![]() |
---|
>sp_v3.0_unigene51785
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | glutathione-dependent formaldehyde dehydrogenase [Chaetomium globosum CBS 148.51] gb|EAQ92487.1| glutathione-dependent formaldehyde dehydrogenase [Chaetomium globosum CBS 148.51] | - | - | 2.0e-13 | 65% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 73% |
Sma3 | Glutathione-dependent formaldehyde dehydrogenase | - | - | 3.813e-07 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | S-(hydroxymethyl)glutathione dehydrogenase. | EC:1.1.1.284 | - | 2.3e-10 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Methane metabolism | 00680 | 2.3e-10 | % |
Source | Gene names |
---|---|
Sma3 | Faldh; GSVIVT00000501001; PHYPADRAFT_137950; POPTRDRAFT_232962; POPTRDRAFT_294427; RCOM_0996200; RCOM_1313890; VITISV_011731; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | alcohol dehydrogenase (NAD) activity | GO:0004022 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
Sma3 | S-(hydroxymethyl)glutathione dehydrogenase activity | GO:0051903 | Molecular Function | 0.0 | - |
Sma3 | ethanol oxidation | GO:0006069 | Biological Process | 0.0 | - |
Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Aliphatic acid kinase, short-chain | IPR000890 | - | 0.0 | - |
Sma3 | Legume lectin domain | IPR001220 | - | 0.0 | - |
Sma3 | Alcohol dehydrogenase superfamily, zinc-type | IPR002085 | - | 0.0 | - |
Sma3 | Alcohol dehydrogenase, zinc-type, conserved site | IPR002328 | - | 0.0 | - |
Sma3 | Alcohol dehydrogenase, C-terminal | IPR013149 | - | 0.0 | - |
Sma3 | Alcohol dehydrogenase GroES-like | IPR013154 | - | 0.0 | - |
Sma3 | Alcohol dehydrogenase class III/S-(hydroxymethyl)glutathione dehydrogenase | IPR014183 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G43940.2 | HOT5 GroES-like zinc-binding dehydrogenase family protein chr5:17684265-17686379 FORWARD LENGTH=391 | 4.0e-16 | 57% |
RefSeq | Arabidopsis thaliana | NP_199207.1 | alcohol dehydrogenase class-3 [Arabidopsis thaliana] | 4.0e-16 | 57% |
RefSeq | Populus trichocarpa | XP_002317673.1 | predicted protein, partial [Populus trichocarpa] | 3.0e-17 | 62% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NZ44
Fln msg: Distance to subject end: 244 aas, your sequence is shorter than subject: 66 - 405
Fln protein:
W
Protein Length:
67
Fln nts:
A
Fln Alignment:
F51TW9001D8XRC___VESVGEGVTDLRKGDHVIPLYNGECEDCVYCKSKKTNLCGEF
A9NZ44_______________VESVGEGVTDIKEGDHVIPLFIGECGDCACCKSNKTNLCEKF
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain