UniGene Name: sp_v3.0_unigene51650
Length: 157 nt
![]() |
---|
>sp_v3.0_unigene51650
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | 5'-3' exoribonuclease 3 [Arabidopsis thaliana] sp|Q9FQ03.1|XRN3_ARATH RecName: Full=5'-3' exoribonuclease 3; AltName: Full=Protein EXORIBONUCLEASE 3 gb|AAG40732.1|AF286719_1 XRN3 [Arabidopsis thaliana] gb|AEE35742.1| 5'-3' exoribonuclease 3 [Arabidopsis t | - | - | 8.0e-12 | 82% |
FL-Next | Isoform 2 of 5'-3' exoribonuclease 3 OS=Arabidopsis thaliana GN=XRN3 | - | - | 0.0 | 82% |
Sma3 | 5'->3' exoribonuclease, putative | - | - | 4.798e-08 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Hydrolases, Acting on ester bonds, Exoribonucleases producing 5'-phosphomonoesters. | EC:3.1.13.- | - | 2.837e-12 | - |
Source | Gene names |
---|---|
Sma3 | AIN1; At1g54490; At1g75660; At5g42540/At5g42550; EIN5; F10A5.15; F20D21.30; GSVIVT00014448001; GSVIVT00031115001; K16E1.2; LOC_Os03g58060; OSJNBb0008G24.22; OSJNBb0021G19.19; Os01g0872700; Os03g0794800; OsI_04616; OsI_13876; OsJ_04252; OsJ_12935; P0491F11 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
Sma3 | 5'-3' exoribonuclease activity | GO:0004534 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | nuclear-transcribed mRNA catabolic process, exonucleolytic | GO:0000291 | Biological Process | 0.0 | - |
Sma3 | nucleobase-containing compound metabolic process | GO:0006139 | Biological Process | 0.0 | - |
Sma3 | mRNA processing | GO:0006397 | Biological Process | 0.0 | - |
Sma3 | ethylene mediated signaling pathway | GO:0009873 | Biological Process | 0.0 | - |
Sma3 | miRNA catabolic process | GO:0010587 | Biological Process | 0.0 | - |
Sma3 | deadenylation-independent decapping of nuclear-transcribed mRNA | GO:0031087 | Biological Process | 0.0 | - |
Sma3 | regulation of gene expression, epigenetic | GO:0040029 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Zinc finger, CCHC-type | IPR001878 | - | 0.0 | - |
Sma3 | Putative 5-3 exonuclease | IPR004859 | - | 0.0 | - |
Sma3 | 5'-3' exoribonuclease 2 | IPR017151 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G75660.1 | XRN3, AtXRN3 5'-3' exoribonuclease 3 chr1:28408289-28414825 FORWARD LENGTH=1020 | 3.0e-16 | 82% |
RefSeq | Arabidopsis thaliana | NP_565114.1 | 5'-3' exoribonuclease 3 [Arabidopsis thaliana] | 4.0e-16 | 82% |
RefSeq | Populus trichocarpa | XP_002306919.1 | predicted protein, partial [Populus trichocarpa] | 2.0e-15 | 87% |
![]() |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q9FQ03-2
Fln msg: Distance to subject end: 94 aas, your sequence is shorter than subject: 52 - 763
Fln protein:
S
Protein Length:
53
Fln nts:
A
Fln Alignment:
F51TW9001DECMK___QKYRSLMIDPNSPIIDFYPTDFEIDMNGKRFAWQG
Q9FQ03-2_____________ERYRTLMTDPNSPIIDFYPTDFEVDMNGKRFSWQG
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain