UniGene Name: sp_v3.0_unigene51578
Length: 234 nt
UniGene Fasta |
---|
>sp_v3.0_unigene51578
A |
Ace file of the UniGene sp_v3.0_unigene51578 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Putative polyprotein n=1 Tax=Oryza sativa Japonica Group RepID=Q6I5H9_ORYSJ | - | - | 3.0e-16 | 57% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 51% |
Source | Gene names |
---|---|
Sma3 | At2g15650; At2g17490; LOC_Os03g26290; LOC_Os03g61660; LOC_Os10g01750; LOC_Os12g05520; LOC_Os12g44200; OSIGBa0134J07.9; OSJNBa0013O08.17; OSJNBa0053E05.7; OSJNBa0065H03.10; OSJNBa0078D06.27; Os10g0106900; SDM1_46t00012; VITISV_000113; VITISV_000236; VITISV |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
Sma3 | adenylate kinase activity | GO:0004017 | Molecular Function | 0.0 | - |
Sma3 | alpha-mannosidase activity | GO:0004559 | Molecular Function | 0.0 | - |
Sma3 | peroxidase activity | GO:0004601 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | ATP-dependent helicase activity | GO:0008026 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | heme binding | GO:0020037 | Molecular Function | 0.0 | - |
Sma3 | carbohydrate binding | GO:0030246 | Molecular Function | 0.0 | - |
Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
Sma3 | response to oxidative stress | GO:0006979 | Biological Process | 0.0 | - |
Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | ATMG00810.1 | ORF240B DNA/RNA polymerases superfamily protein chrM:227709-228431 REVERSE LENGTH=240 | 2.0e-19 | 51% |
RefSeq | Arabidopsis thaliana | NP_085537.1 | hypothetical protein ArthMp070 (mitochondrion) [Arabidopsis thaliana] | 2.0e-19 | 51% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LKV8
Fln msg: Distance to subject end: 109 aas, your sequence is shorter than subject: 77 - 363
Fln protein:
L
Protein Length:
78
Fln nts:
A
Fln Alignment:
SPI_Ppin_R14-1306-T7.Ab1___LYVDDLILTGDKMLILSCKKDLATEFGMKDLGLLHYFLGLEIWQRSGGLFVSQGKYAREILEKFNMHGCKPVDTPL
B8LKV8_______________LYVDDLIYTGN-LTIDMFKSAMKKEFEMTDLGLMNYFLGIEVTQKDKGIFICQSKYARDVLKRFRMINCSPVSTPV
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain