UniGene Name: sp_v3.0_unigene51310
Length: 170 nt
UniGene Fasta |
---|
>sp_v3.0_unigene51310
C |
Ace file of the UniGene sp_v3.0_unigene51310 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Aldolase (Fragment) n=2 Tax=Heterodera RepID=Q5J797_9BILA | - | - | 7.0e-05 | 50% |
FL-Next | sp=Fructose-bisphosphate aldolase; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 65% |
Sma3 | Fructose-bisphosphate aldolase | - | - | 0.0 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Fructose-bisphosphate aldolase. | EC:4.1.2.13 | - | 0.0 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Glycolysis / Gluconeogenesis | 00010 | 0.0 | % | |
Sma3 | Pentose phosphate pathway | 00030 | 0.0 | % | |
Sma3 | Fructose and mannose metabolism | 00051 | 0.0 | % | |
Sma3 | Methane metabolism | 00680 | 0.0 | % | |
Sma3 | Carbon fixation in photosynthetic organisms | 00710 | 0.0 | % | |
Sma3 | Biosynthesis of phenylpropanoids | 01061 | 0.0 | % | |
Sma3 | Biosynthesis of terpenoids and steroids | 01062 | 0.0 | % | |
Sma3 | Biosynthesis of alkaloids derived from shikimate pathway | 01063 | 0.0 | % | |
Sma3 | Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid | 01064 | 0.0 | % | |
Sma3 | Biosynthesis of alkaloids derived from histidine and purine | 01065 | 0.0 | % | |
Sma3 | Biosynthesis of alkaloids derived from terpenoid and polyketide | 01066 | 0.0 | % | |
Sma3 | Biosynthesis of plant hormones | 01070 | 0.0 | % | |
Sma3 | Metabolic pathways | 01100 | 0.0 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 0.0 | % |
Source | Gene names |
---|---|
Sma3 | ALDC; ALDO; AT3G52930; AT4g26530; Aldo; At2g36460; At3g52930; At4g26520; At4g26530; At5g03690; B1203H11.11; B1417F08.1-1; B1417F08.1-2; F17C15.11; F17C15_110; F8J2_100; FBA; FBAI.1; GSVIVT00021665001; LOC_Os05g33380; LOC_Os10g08022; M3E9.40; M3E9.50; MICP |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
Sma3 | nucleolus | GO:0005730 | Cellular Component | 0.0 | - |
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | mitochondrial envelope | GO:0005740 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
Sma3 | fructose-bisphosphate aldolase activity | GO:0004332 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | response to hypoxia | GO:0001666 | Biological Process | 0.0 | - |
Sma3 | glycolysis | GO:0006096 | Biological Process | 0.0 | - |
Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Fructose-bisphosphate aldolase, class-I | IPR000741 | - | 0.0 | - |
Sma3 | Vesicle transport protein, SFT2-like | IPR011691 | - | 0.0 | - |
Sma3 | Aldolase-type TIM barrel | IPR013785 | - | 0.0 | - |
Full-Lengther Next Prediction |
---|
Fln status: Putative N-terminus
Fln database: coniferopsida.fasta
Fln subject: A9NMQ0
Fln msg: Distance to subject end: 293 aas, atg_distance in limit (1-15): atg_distance = 9, W2: There is no M at the beginning, your sequence is shorter than subject: 56 - 358
Fln protein:
R
Protein Length:
57
Fln nts:
C
Fln Alignment:
EPDB_BX680264___RAELKENAERIARRGFGILAADESTGTIGKRFDNIKXXXXXXXXXXXXXXXFTTP
A9NMQ0_______________RDELIANAAYIATPGKGILAADESTGTIGKRLASINVENIETNRRQLREFLFTAP
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain