UniGene Name: sp_v3.0_unigene51302
Length: 176 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene51302
T |
Ace file of the UniGene sp_v3.0_unigene51302
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Cytochrome P450 750A1 n=1 Tax=Pinus taeda RepID=C75A1_PINTA | - | - | 6.0e-20 | 77% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 82% |
| Sma3 | Cytochrome P450 | - | - | 3.339e-20 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | EC:1.14.-.- | - | 1.575e-09 | - | |
| Sma3 | Flavonoid 3',5'-hydroxylase. | EC:1.14.13.88 | - | 7.521e-06 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Flavonoid biosynthesis | 00941 | 7.521e-06 | % | |
| Sma3 | Flavone and flavonol biosynthesis | 00944 | 7.521e-06 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 7.521e-06 | % |
| Source | Gene names |
|---|---|
| Sma3 | AT4g12310; At1g66540; At2g45570; At3g48290; At4g12310; CYP71A1; CYP71A24; CYP71D20; CYP71D21; CYP71D54; CYP736A3v2; CYP736A5v1; CYP736A9; CYP750A1; CYP76C2; CYP81B13P; CYP81B25; CYP81B4; CYP81B5; CYP81B6v1; CYP81B6v2; CYP81B7; CYP81B9P; CYP81Q1; CYP81Q2; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | endoplasmic reticulum membrane | GO:0005789 | Cellular Component | 0.0 | - |
| Sma3 | microsome | GO:0005792 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | monooxygenase activity | GO:0004497 | Molecular Function | 0.0 | - |
| Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
| Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
| Sma3 | heme binding | GO:0020037 | Molecular Function | 0.0 | - |
| Sma3 | fruit ripening | GO:0009835 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Cytochrome P450 | IPR001128 | - | 0.0 | - |
| Sma3 | Cytochrome P450, E-class, group I | IPR002401 | - | 0.0 | - |
| Sma3 | Cytochrome P450, conserved site | IPR017972 | - | 0.0 | - |
| Sma3 | IPR017973 | - | 0.0 | - | |
| Sma3 | Peptidase S26A, signal peptidase I, conserved site | IPR019758 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G66540.1 | Cytochrome P450 superfamily protein chr1:24824837-24826502 FORWARD LENGTH=386 | 1.0e-18 | 65% |
| RefSeq | Arabidopsis thaliana | NP_001117558.1 | putative cytochrome P450 [Arabidopsis thaliana] | 7.0e-19 | 65% |
| RefSeq | Populus trichocarpa | XP_002334744.1 | cytochrome P450, partial [Populus trichocarpa] | 2.0e-21 | 63% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: C0PPU6
Fln msg: Distance to subject end: 94 aas, your sequence is shorter than subject: 58 - 526
Fln protein:
Y
Protein Length:
59
Fln nts:
T
Fln Alignment:
EPDB_BX679684___YLHSVVKETLRLYPGGPLAVPHESSEAVTVRGYHIPKKTMLMVNVWAIGRDPNVWG
C0PPU6_______________YLHCVVKETLRLYPAVPLMVPHESVEAVTIAGYYIPKKTTVMVNVWAIGRDPNVWG

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta