UniGene Name: sp_v3.0_unigene51290
Length: 134 nt
![]() |
---|
>sp_v3.0_unigene51290
C |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | putative protein phosphatase 2C 15 [Arabidopsis thaliana] ref|NP_001031252.1| putative protein phosphatase 2C 15 [Arabidopsis thaliana] sp|Q9M9C6.1|P2C15_ARATH RecName: Full=Probable protein phosphatase 2C 15; Short=AtPP2C15 gb|AAF26041.1|AC015986_4 putat | - | - | 3.0e-15 | 90% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 86% |
Sma3 | Protein phosphatase, putative | - | - | 2.16e-11 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Phosphoprotein phosphatase. | EC:3.1.3.16 | - | 4.728e-19 | - |
Source | Gene names |
---|---|
Sma3 | AT1G68410; At1g09160; At1g47380; At1g68410; B1045B05.36; GSVIVT00005631001; GSVIVT00014800001; GSVIVT00022659001; GSVIVT00030384001; H0818E04.11; LOC_Os01g32964; LOC_Os02g35910; LOC_Os03g18970; LOC_Os03g27780; LOC_Os04g37660; LOC_Os09g28560; MtrDRAFT_AC14 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | magnesium ion binding | GO:0000287 | Molecular Function | 0.0 | - |
Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
Sma3 | catalytic activity | GO:0003824 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | phosphoprotein phosphatase activity | GO:0004721 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | manganese ion binding | GO:0030145 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Protein phosphatase 2C, manganese/magnesium aspartate binding site | IPR000222 | - | 0.0 | - |
Sma3 | G-patch domain | IPR000467 | - | 0.0 | - |
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | Protein phosphatase 2C-like | IPR001932 | - | 0.0 | - |
Sma3 | Zinc finger, C2H2 | IPR007087 | - | 0.0 | - |
Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
Sma3 | IPR014045 | - | 0.0 | - | |
Sma3 | Protein phosphatase 2C | IPR015655 | - | 0.0 | - |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Sma3 | IPR017442 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G68410.1 | Protein phosphatase 2C family protein chr1:25650262-25652255 REVERSE LENGTH=436 | 7.0e-21 | 90% |
RefSeq | Arabidopsis thaliana | NP_177008.1 | putative protein phosphatase 2C 15 [Arabidopsis thaliana] | 9.0e-21 | 90% |
RefSeq | Populus trichocarpa | XP_002312412.1 | predicted protein [Populus trichocarpa] | 6.0e-21 | 93% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LLF8
Fln msg: Distance to subject end: 196 aas, your sequence is shorter than subject: 44 - 436
Fln protein:
A
Protein Length:
45
Fln nts:
C
Fln Alignment:
EPDB_BX679152___ASGGEVGRLSIVGGAEVGS-RCWPGGLCLSRSIGDMDVGEFIVP
B8LLF8_______________ASGGEIGRLNTVGGAEIGPLRCWPGGLCLSRSIGDMDVGEFIVP
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain