UniGene Name: sp_v3.0_unigene51258
Length: 247 nt
![]() |
---|
>sp_v3.0_unigene51258
T |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Glutathione S-transferase-like protein (Fragment) n=9 Tax=Picea sitchensis RepID=E5F6M4_PICSI | - | - | 3.0e-23 | 73% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 75% |
Sma3 | Glutathione-S-transferase | - | - | 1.636e-06 | - |
Source | Gene names |
---|---|
Sma3 | At2g47730; F17A22.12; GST6; GSTF1; GSTF2; GSTF4; GSVIVT00023540001; GSVIVT00023541001; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | chloroplast stroma | GO:0009570 | Cellular Component | 0.0 | - |
Sma3 | thylakoid | GO:0009579 | Cellular Component | 0.0 | - |
Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
Sma3 | glutathione transferase activity | GO:0004364 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | transferase activity | GO:0016740 | Molecular Function | 0.0 | - |
Sma3 | glutathione binding | GO:0043295 | Molecular Function | 0.0 | - |
Sma3 | toxin catabolic process | GO:0009407 | Biological Process | 0.0 | - |
Sma3 | response to cold | GO:0009409 | Biological Process | 0.0 | - |
Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
Sma3 | defense response to bacterium | GO:0042742 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Lipocalin | IPR002345 | - | 0.0 | - |
Sma3 | Glutathione S-transferase, N-terminal | IPR004045 | - | 0.0 | - |
Sma3 | Glutathione S-transferase, C-terminal | IPR004046 | - | 0.0 | - |
Sma3 | Glutathione S-transferase, C-terminal-like | IPR010987 | - | 0.0 | - |
Sma3 | IPR012335 | - | 0.0 | - | |
Sma3 | Glutathione S-transferase/chloride channel, C-terminal | IPR017933 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT2G47730.1 | ATGSTF8, ATGSTF5, GST6, GSTF8 glutathione S-transferase phi 8 chr2:19558213-19559266 FORWARD LENGTH=263 | 9.0e-20 | 56% |
RefSeq | Arabidopsis thaliana | NP_850479.1 | glutathione S-transferase 6 [Arabidopsis thaliana] | 1.0e-19 | 56% |
RefSeq | Populus trichocarpa | XP_002321317.1 | predicted protein, partial [Populus trichocarpa] | 2.0e-18 | 53% |
![]() |
---|
Fln status: N-terminus
Fln database: coniferopsida.fasta
Fln subject: D5AAN1
Fln msg: Distance to subject end: 145 aas, your sequence is shorter than subject: 69 - 214
Fln protein:
M
Protein Length:
70
Fln nts:
T
Fln Alignment:
EPDB_CR394335___MAMIKVHGHHLSTATRLVLCCLEEKQIDYEVAFVNLSAGDHKQTQYLALNPFGVIPTIQDGVLTLFESR
D5AAN1_______________MAKIKVYGHPISTATRLVLCCLHEKKVEYDFVLVELSAGAHKQPQYLALNPFGVLPTIQDGDLTLFESR
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain